Identifiers and Description

Gene Model Identifier

Contig10868.0.g98

Standard Name

TP53I3a

Aliases

Contig10868_0_g98

Description

Zinc-binding dehydrogenase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00107 ) Zinc-binding dehydrogenase
  • ( pfam13602 ) Zinc-binding dehydrogenase
  • ( pfam08240 ) Alcohol dehydrogenase GroES-like domain
  • ( pfam00291 ) Pyridoxal-phosphate dependent enzyme

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000285302.000383902553626e-98oxidoreductase, zinc-binding d
ehydrogenase fa...
SGDYBR046C7.999528511121947e-28ZTA1 SGDID:S000000250, Chr II
from 331511-330507, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10868.0.g98(coding)
ATGGAATCCACGTCAACTACTCAAAAAATGAAAGCTATCATTCAGGAATAAACTGGTGGT
GCAGAGACTCTTATTCCTGGAGAAGTAGATCTACCTATACCAAAGGAAGGGGAAGTCTTA
ATTAAAATTGAATACTCAGCACTTAACAGAGCAGACATCATGCAGAGAAAAGGAACCTAT
CCACCTCCACCAGGAAGCACCAGCATTATTGGCTTAGAATGTGCAGGTTATATTGTAAAT
GATCTCAGTGAACTTCAAGATGAGAAATACAAGCAAAACAGAAGAGTTATGGCTCTCTTA
CCAGGCGGTGGCTATGCCCAATTTGTGACTGTGCATTAAAACCAGGTAATGGATATCCCT
GAATCTTTCTCCTTCGAGCAAGCAGCCGCTATCCCAGAAGTATGGTGCACAGCCTTCTAG
ATTTTGGTCCTCATTGCTAACATTCAAAAGAATGAGACAGTTCTTGTACATGCAGCAGCT
GCAGGAGTTGGTACAAGCATGATTTAATTGTGCAAAAAATACGGTGCTAAGGTTATAGCT
GTGTCATCCTCAGAAAAGAAACTTAAGTTTTGTCAAGAATTGGGAGCTGATTACTTGATC
AACTACAAAGAGAATCCTGATTTTTCTAAGCTTGTACAAGAGTATACAAATGGAAAGGGA
GTTGATGTGATTGCAGATCCAGTACTTGCTTCAAACTTCCAATATAACATTGACAGCTTG
GCAATGGATGGCAGATGGGTAGTCTATGGAACTATGGGCGGAACTTTAATTGAAAACTCA
AACTTTGGACTTTTATTGAGAAAAAGAGCAAACATTCAATTCACTACACTAAGAAACAGA
ACTATAGAGTACAAAGGAAATTTGATCTAAAGACTCTAGAATGAATGTCTTGCTGAGTTC
AATAGTGGATTGCTGAAACCTATTGTTGATAAAGTTTACGGATTCAGTCAAATTCAAGAG
GCTCATCAATATATGGAGAGCAACGAAAGTATTGGTAAAATTTTAATCAAGTATGATCTT
TGA


>Contig10868.0.g98(protein)
MESTSTTQKMKAIIQEQTGGAETLIPGEVDLPIPKEGEVLIKIEYSALNRADIMQRKGTY
PPPPGSTSIIGLECAGYIVNDLSELQDEKYKQNRRVMALLPGGGYAQFVTVHQNQVMDIP
ESFSFEQAAAIPEVWCTAFQILVLIANIQKNETVLVHAAAAGVGTSMIQLCKKYGAKVIA
VSSSEKKLKFCQELGADYLINYKENPDFSKLVQEYTNGKGVDVIADPVLASNFQYNIDSL
AMDGRWVVYGTMGGTLIENSNFGLLLRKRANIQFTTLRNRTIEYKGNLIQRLQNECLAEF
NSGLLKPIVDKVYGFSQIQEAHQYMESNESIGKILIKYDL