Identifiers and Description

Gene Model Identifier

Contig21824.0.g104

Standard Name

TOR

Aliases

Contig21824_0_g104

Description

Phosphatidylinositol 3- and 4-kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001476009.997093137033517e-262Phosphatidylinositol 3- and 4-
kinase family p...
SGDYKL203C9.997093137033517e-262TOR2 SGDID:S000001686, Chr XI
from 63359-55935, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21824.0.g104(coding)
ATGGCGTCATAATTAATAAAGAACGTAGAATTGACTCGAATTTTTAAGGATTTGAAGTCT
AAGCAAGTTGCTGTTCAGCAAGAAGCGTCAAGAAGGCTATACCAATATTTGATAAAACAC
AATGAAGACTGCGACTATATTTTTGAGGAGTTCTATCAGCTCCTTCAGTCAGATGTCAAG
GAATAGAAACTTGGTTGCTTCATTGCGATTAATAAGATACTCACAGTGGGGCGAGAAACT
AGGATCGTTCATTATGTCAACAAAATCATGCCTATGATCACAAAGCAAATGAAAATCAAT
AACACTGAGCTCGCTGAGAAGGCTGCTGAATGCCTGGGAAACCTTGCGAAAGCAGGTGGT
AGCATTACTGCAGAAATTGTAGAACAAACTCTTGAATAGGCAATCAGCTGGCTCTCATCT
GATAAGAGCTCAAAATCCACGGATATCAAAAAGTATTCTGGAGTCTTAGTACTAAGAGAG
TTCTGTAAGAAACTTCCTATAGTCACATTCAATAAGCTATTTGATGGTACCAACTCTTAC
AAGTAGATATTCTTAGCTTTCAGGGATCCAAGAGTAAACGTGAGAGATACAGCTGCTGAA
TGTATTAACGTATGCTTAAGCTTAATTTCAGAAAGAGAATCAAAGTAATCTAAACATGGG
CTTCAGAAACTTATCTATGATGAGATTTAGATAGCTTTTTAAGACACTGATCCAAACTAT
CAACATTCAGCCTTAACTATTCAAGGAAAGACAATTATTGAAAACGTTATGAAGATGCAC
GAGACTAACAAAGCTAGTCCATTTGTGAAAAAGAAATGCATCGAAATCATGCCACTACTC
GTAAAATACATCTAGCCTTACTTCTCTGATGCTCACCTTGAACTCTCGCTTAAGGCCATT
TTCGCCTTTATAACAAAGAAAGACAATAAGGACAGAGGTTAGGGATTTCTATCCCTTGGT
AAAATGGGTTTGCTGGTCTAAAAAAGCAAGTTCAATAGATACTTAGGAGATGTCTTTAAC
TTACTCGAGAAGGAAATCGTTGCAGTCAAGCCTAAACTTCCAAATTAAAACAACAAAAAT
GTCATCACTCTTGAAATACTTACTTGCATTAAAATGCTGCTCAGAAACTTTGGAGATGAC
TTTGACAAAAGATACGATATGGTTTATTTTGTGAATGATTTGTTCTTTTTTGGATTCAAC
AAGCAGCTTATAGAGACTCTAGCTGAACTTTCAAAGATATGTCAAGGGAAGTATAAGATG
ATCACTTAGATTAAGCTACTTAATGCAATCTCTATTATTTTGACTTTGAAAACAAATCAT
TTCCCCATTGGATTAGACAACTTAAAGAGACAAAAGAATCATGATGGGTAAATACAGCAA
CAAAGCTACTCTCATAATTAGAGAAAAGATTCGAATCAATCTAATTCACCTGACAAGGGA
TAAGATTAACTCTCTATGATGGGTTAATCAGTCGACTACCACAGGAAAGAAAGTGGAGAT
ACAAACACAATTTCAAATGCCTTGAATTAGGAAGAAGAATTAAAGAATGGTCTTTTGGAA
TTATAAAGTTAGAACTTGCAGCTCAAGAAAGACAAGAATGGAAACATCTAAAACCACTTA
GTCATCGACATTTCAACTTTAAAGAAACTTTTAAATAAGGCATCCTGCGAATTCATTCTA
AGCTTGATCCAAGGAACTAACGAAAAAGAGAAAGATAAGGGAGAGCAACAATTGAACTAA
AAAACTTAATTAGTCACACTTGCTCTTAAGACCCTGGCATCATATGATTTCACTGAGTTT
AGTGACAGTGTTACTTAATTCATTGAAAATTCAGTCCTTAATTATCTAGATGATGAAAAT
CCAACTGTCAGGAAAGATGCAGTTAAAACTTGCTGCTCGCTTAGCTTTTCATAATCTAAT
GGTCAGTCACTCCAAAGACTTGGAGCGGTTATGATAAGAATCGTAAACAAACTACTTCAC
AAATTCTTCGTAACTGCGACTACTGATAATGACTATAGAATAAGATGCACTATGCTAAAA
TATCTGAACTCACAATTTGATCCGTTTATTTCAAGGTATGAAAATTTGCTCATGCTTTTC
AACTGTATGCAGGATTCAAACTTCGACATCAAAGATAGAACAGTCAGAATTCTTGGTAGA
CTAGTCAATCATAATGCTTCTTAAATTTTGCCTTACTTAAGACATCTCATAATTTCATTA
ATGAGTCAGTTAGAGCACAGTAATGATATTAAAGAGAGAGAGGAAGCAGCTAAATTGATA
AAAACTTTTGTGAGGTCTAACAAGGATCTTTCAAAATCTTATGCTAACTCCATTCTTAAA
AGTCTTATTCAAAAGATCGAGGGTGAGTAGGCAACATCTGCCTTTATATCAGCTGTCTTA
GAAGCGATTGGAGAAATTTCAAATGTAGATAGTGAGTCAATTAAACCATACATGGGAGAC
CTACTTCCTTTAATACTTGAATGTATTAAAGATTAGAGTAGTGCTTAGAAAAGAGAAGTT
GCAATTAAAACTCTAATTGCTATTATTGAGAACACGGGATTTGTAATTAAGCCTTACTTT
TTCTTCCCTGAAATACTATAGTATATCAGAAACCTGGTCTAGAACGAATAATCCAGTACA
ATTAAGAAGTTAGTCTTCAAACTTATCGGTACTCTGGGTGCCTTGGATCCCTATTTAGTG
AAATAAATTTAGATATACTATAACAACTCTGAGGGAATTGATGGGGGTGACATGCATGCT
AACATACCACTTCTCAAAATGATTGACTAGCAACTTAATAATCCAAATCAAAAATAAGGA
TAGTAGAATATGATTGAGCAACACAAAGGATACTCTGACATTATGACATAGTCTTCAATA
ACTAAGAATATATTTTTGAAGAGAAAGTATATAGAAGAGGCTGAAAATTAGAAATAAATT
AATAGCATAATTACTATAAATGAGATGAATATAGCTAATCCAGCATTTAAAGACATGCCC
ATGATCTAATTTTATAATCAACTTGGACAACGAGGTTAGGACATGATTAAGTACCTTAAG
AAGTACGACTTTTAAGAAACTAAAGAAAATAAGTATCCTACAAAGGCAATATAACATTTG
ATCAAGGTGCTTTTGGATCAAACTTTAAGAGATCATCATGAAATTGTATTGAACGGTATT
AAGTATATAGTGTATAACCTTGGTCAGGATTCTGTCATGTTTCTTCCATTAATCATTCCT
CCACTTATGACTTTAATAAAAACTAATGATCCAGTTTTGAATGAAAGTCTCTATCAATGC
GTTAATGCCATTATTGGTACAGTTCCAAAGTCTATTGATAAATTCTCTGACATAATCTTT
GACACAATTAATGATGTACTTTAGATTTAAGCAATTTAAGTTCTTGAACTAGTAAGGCTT
TTGAATGTTAATTGCAAGGAGCTTCTTTTGACAGACATGTACTTGCTTCTGCCAAAAGTT
GTCTAGTTAGTTGAACATAAAAGAAATTCTTAAGATATACATGTCTCTATTAAAGCAGTG
TAGACAATTAAGGAATTTCACACTTCTATCTTAGATGATCATTTATACATTATCATACCT
CTGCTTTTGAGAATAGGATCTAATGGTATTTAAGGTGCTGATTTAAGTTTGAGTATTGAA
ATCTTAAAAACTATTGATACTTTAAAAGAATGTACTTGCTTCAGGGAACATGTAGGTTAA
ATTGTACATCAACTCCTACAAGTTATGGAAACTTCTCCAAATTTGACAAATTTAGTTTAA
GAAATATTAAGACTCTTCACTTCAATAGCTGGAAAATTGTTAATAGATTTCGCACCTTAT
ATATCTTTGATTCAAAAAGCAATAAAGAGAAACAAACTTTAATTTGAAGATTTTGATATT
AAAGTAGAGGAAATCACAAGAGTAAATCCTATAGATATTTTCTACAATAACCTTAAATTT
TCTCAAATACAAGAAGAAGAAAGGTAGAGACAGCAAAACGTAAATGAAGCAGCACAAATT
CAAAGTCAAAACAATCTACCAAAAAAGACTATGTTAGAAGCTTAAGAAATCAGAAAAAAG
CATATAAATTTTGATGTTCTTTTGAAGGAATTCGAAACCTCAAAATGCTCTATCGAAGCC
GATTGGATTGAATGGCTTAAGAAAACTTCTCACCAGTTACTAAGACAATCCCCTTCACCT
ATTTTGTTTGCTTGTAGTACCCTTGCTGAAGTTTATGCTCCAATAGCCAATGAACTTTAC
AATATTGCTTTCGTTAGTTGCTGGAAGATTATGAATGATAAAGGAAAAGAGAGAATTCTC
GATAATTACCTTAATGCAATCAAATCCTCAAGCAAGCCAACCATAGTCCTTCAGACCATA
CTTAATCTTGCCGAGTTTATGGAGCTCGATGACAATACAGACTATAAATTGTTCTCAGCA
AGTACCTTGGCCAGAATAGCTGAATAATGTAATGCATATGCCAAAGCCCTTTATTATTGG
GAATTGGAATTTGATAACGATCCTAAAAATACCATTGAACTATTAATTCAAACAAACTAT
GGACTTCAATAGCCAGAAGCTGCAGAGGGTATACTTGAATATGCTAAGAAAAATATACTC
ATAGATGAGAAAGAGGATTGGTATGAAAAACTTCATAGATGGAGAGATGCTCTTAGAATA
TATGAACAGAAGCAAATTTAAGATCCAAACAGCTTCGAAATTCTAAAAGGTAAAATGAAT
TGTTTCAGAAATCTCTTTGACTGGCAAAATTTATCTTCTCTTGTTGAGTAAATGTGGGAC
TAGTAACAATAAGTTGATAGAGTCAGTGAATCTACAGTTTTTACAAATTAAAATATTGCT
TAAGTTTAATAAGTTTCAGAATTTGCATGCTACGCAACTTGGAATATGGGTAACTGGGAA
AATCTTTAAAAGTTTGTTAAAGTGCTAGATGGATAGAAAAATCCATACGAGAGATATTTC
TTCCAAGCAATATTGGATATCAAGAATGATAAATATAATGAAGCTTAGAAGCATATTGAT
AGAGCAAGAGAAGTTTTAGATCCAAAAATTACTTCATTACTTGGCGAGAGTTACAACAGA
GCATACATCTTAATATAAGAAATGCAAAATTTAAGAGAACTAGAAGAGATTATTGAGTAT
AAACAACCATCAACTGATTTCTCTAGAAAGAAGCATTTATATTTACTTTGGTGCAATAGA
CTTGAGTATTAACCTTCACATGATCTAGAATAGTGGTAGAAGAGTTTGAACATTAGGAAT
CTAGTTATCGATAGATCTGAGGAAATAGATTACTACTTAAAGTTTGCAAAACTCGCACAA
AACAATGGAAATAATGACTTAGGTCAAAGAGTGCTTCTAAACTTGAAGAACGAATTAATA
AAAACTAAAGCTGAGAAGTCACTTAAGTTAACAAATTAACTTGCTAAAGTTGAATTTGCC
ATATAATAGACTGTATTTATTTCTGGTAAACACTCCGAAGCTATCTAGAATTTGAAGAAG
CTTCTAAGAGACAAAGAAGACATGGATCCATAGATCAAAAGTGATTGCGAACTAAAATTA
GGTTAATGGCACTATGAACAGTAAGACTTCAAGAAAGCTAACTTAGGAGAGGAAGATTAT
CAAATTATATTACAGAGCTGTGAAAAAGCTACTACTATTCATCATAATAATTAAGATGCT
TGGCATTTTTACTCTCAAATGAACTACGAGGCATGCATTTATTACTCTAAGAGATTAAAT
GAGGAATTTTAACAAATGTCTGAAAATCCAGCATAGAGCCATTAAACAAATATCTTTGAT
GATTTCCAACCTTAAACTGCATTCTAAATTCAATAACTACAAGCACATGCTACTTTAGGA
TAGAAACAGCTCGGATAAAAATATGTCTATCATGTAGTTTGTGCAATTAAAGGATTAGTT
TAAATATTGTCTCTCAGTGATCAAATGTACTTCTCAGATTAGACTAAAACCTTATAAAAT
ACTTTAAGACTTTTAAAACTTTGGTTTAGACATGGTAATTTAATCGAAATTGAACAAATT
ATAAGAAATGGCTTTGAAAAGATAGATTTAAAGATATGGATTGATGTCATTCCTTAATTA
CTAGCCAGAGTTGATATCAAAGATCATATCATAAGAAAGTCATTGATAGATCTATTGGAA
AGGATTTCCTAAAAATTTCCATAAGCTCTTATATATAGTTTGTCTGTGCTTCAAAAATCA
AAGACAATTGAGAGAAGAAAAGCAGCTGATTAATTAATTGAGAAATTAAAACTAAAACAG
CCAATTCTAATTGAGCAAGCAACAATGATTTCAGATGAGCTTATAAGATGTGCTATTGTA
CATGCTGAGATATGGAATGAAGCAATTGAAGAAGCAAGTAGAATATACTTTGGTCAAAAT
GACGCAAAGGCAATGATAAATTATTTAGCACCACATCATAAAATGATGGAAGCCCTACCA
GAGACTATGAATGAAATTGCATTTTACTAAGGATATGCAAGTGATTTACAAGAAGCTGAA
GGATGGTGCAAGAGATATTAGTAGACAAAGAATTAAACAGAAATTAATCAGGCTTGGGAC
ATATACTTAAACGTATTTAGAAAGATATCTGGTAAACTAAAAGAAGTATAATTCTATGAA
TTGAAAAATGTAGCACCAAAGCTATTAAGTTCAGAAAATCTAGATATTGCTGTTCCTGGA
ACTTTTAAGAGTGATAGAAAGATTGTAAAAATCTCAAAGTTTGCATCTGTTCTTCCAGTT
TTATCATCAAAATAACATCCTAGAAAAATGCAAATTTATGGCAGCGATGGAAAAGAATAT
ATGTTTTTGTTGAAGGGTCATGAAGATATTAGGCAGGATGAGAGAGTCATGTAGTTGTTT
GGACTAGTGAATACACTGTTAACTATAGATCCATAGACAAGCAAGAAAGATTTATCGATC
AGAAGATACCCAGTAATTCCCTTAAGTTAAAATACAGGACTTATTGGATGGGTCCCGAAT
TGTGATACTCTTCATTAATTGATTAAGGATCATAGAACATAGGCAAATATTATACCAAAC
ATCGAATATAAGCTTATGGAGTCAATGTGTGATCATTTTGATATTTGCCCAATCCCTAAT
AAGGTGGAAATTTTCAGGTATGCACTTGATAGAACTATGGGAGAAGATCTATAAAAAGTG
CTGTGGTTAAAGTCTTAAAATTCTGAGCTCTGGCTGGAAAGAAGAACTAATTATACTAGA
TCTCTAGCTGTGATGTCTATGGTGGGGTATATACTAGGTCTCGGAGATAGGCATCCTTCA
AACATTATGCTTGATAGATACTCAGGCAAAATTATTCACATTGATTTTGGAGATTGTTTT
GAAATCGCAATGAGAAGAGAAAAGTTCCCTGAAAAAATTCCCTTCAGGCTTACAAGAATG
CTTATTAAAGCTATGGAAGTCTCTGGTATAGAAGGTAACTTCAGAACTACTTGTGAGAAC
ACAATGAGAGTTATGAGAGCAAGTAAAGAATCCCTACTTGCAATTCTGGAAGCTTTCGTC
TATGATCCTCTAATCAGTTTTAAGTTGCTTAACCCAAAGATCCTTAAACAAAATCAACAG
AAAAATCAAGACTAAAATGGTCAGCCATAGTAAGAAGAGTAAAAGAACTCTGCTAATAAT
GCATTCGCTCCAAGAAGCATGACCGCAAAACGGGGAAAACCTGGTACTGTTAGGGAGTCT
ATAGTTGAATAAGTACTTGAAAGATTCCAGAAGCATCATGGAAAAGAAGAGTATAATTAA
AACTATGCTGAGAGTAAGTTCTCTAGAAAAATGGAAGAAAAGGAACTTATGTACATGATT
GAGGAGGAAGGAGAAGACGCTAGGAGATAAGAGCTTAACTAGACAGCTGAAATTGTCATA
TAGAGAATTAATGATAAACTTAGAGGTATGGAGTTCCAGCATGGGTAAAAAATGGATATT
GAAAGATAGGTCGATAACTTAATCAAGCAGGCGGCTAGTCATGAAAATTTGGCTTAATGC
TATATAGGTTGGTGTCCATTTTGGTGA


>Contig21824.0.g104(protein)
MASQLIKNVELTRIFKDLKSKQVAVQQEASRRLYQYLIKHNEDCDYIFEEFYQLLQSDVK
EQKLGCFIAINKILTVGRETRIVHYVNKIMPMITKQMKINNTELAEKAAECLGNLAKAGG
SITAEIVEQTLEQAISWLSSDKSSKSTDIKKYSGVLVLREFCKKLPIVTFNKLFDGTNSY
KQIFLAFRDPRVNVRDTAAECINVCLSLISERESKQSKHGLQKLIYDEIQIAFQDTDPNY
QHSALTIQGKTIIENVMKMHETNKASPFVKKKCIEIMPLLVKYIQPYFSDAHLELSLKAI
FAFITKKDNKDRGQGFLSLGKMGLLVQKSKFNRYLGDVFNLLEKEIVAVKPKLPNQNNKN
VITLEILTCIKMLLRNFGDDFDKRYDMVYFVNDLFFFGFNKQLIETLAELSKICQGKYKM
ITQIKLLNAISIILTLKTNHFPIGLDNLKRQKNHDGQIQQQSYSHNQRKDSNQSNSPDKG
QDQLSMMGQSVDYHRKESGDTNTISNALNQEEELKNGLLELQSQNLQLKKDKNGNIQNHL
VIDISTLKKLLNKASCEFILSLIQGTNEKEKDKGEQQLNQKTQLVTLALKTLASYDFTEF
SDSVTQFIENSVLNYLDDENPTVRKDAVKTCCSLSFSQSNGQSLQRLGAVMIRIVNKLLH
KFFVTATTDNDYRIRCTMLKYLNSQFDPFISRYENLLMLFNCMQDSNFDIKDRTVRILGR
LVNHNASQILPYLRHLIISLMSQLEHSNDIKEREEAAKLIKTFVRSNKDLSKSYANSILK
SLIQKIEGEQATSAFISAVLEAIGEISNVDSESIKPYMGDLLPLILECIKDQSSAQKREV
AIKTLIAIIENTGFVIKPYFFFPEILQYIRNLVQNEQSSTIKKLVFKLIGTLGALDPYLV
KQIQIYYNNSEGIDGGDMHANIPLLKMIDQQLNNPNQKQGQQNMIEQHKGYSDIMTQSSI
TKNIFLKRKYIEEAENQKQINSIITINEMNIANPAFKDMPMIQFYNQLGQRGQDMIKYLK
KYDFQETKENKYPTKAIQHLIKVLLDQTLRDHHEIVLNGIKYIVYNLGQDSVMFLPLIIP
PLMTLIKTNDPVLNESLYQCVNAIIGTVPKSIDKFSDIIFDTINDVLQIQAIQVLELVRL
LNVNCKELLLTDMYLLLPKVVQLVEHKRNSQDIHVSIKAVQTIKEFHTSILDDHLYIIIP
LLLRIGSNGIQGADLSLSIEILKTIDTLKECTCFREHVGQIVHQLLQVMETSPNLTNLVQ
EILRLFTSIAGKLLIDFAPYISLIQKAIKRNKLQFEDFDIKVEEITRVNPIDIFYNNLKF
SQIQEEERQRQQNVNEAAQIQSQNNLPKKTMLEAQEIRKKHINFDVLLKEFETSKCSIEA
DWIEWLKKTSHQLLRQSPSPILFACSTLAEVYAPIANELYNIAFVSCWKIMNDKGKERIL
DNYLNAIKSSSKPTIVLQTILNLAEFMELDDNTDYKLFSASTLARIAEQCNAYAKALYYW
ELEFDNDPKNTIELLIQTNYGLQQPEAAEGILEYAKKNILIDEKEDWYEKLHRWRDALRI
YEQKQIQDPNSFEILKGKMNCFRNLFDWQNLSSLVEQMWDQQQQVDRVSESTVFTNQNIA
QVQQVSEFACYATWNMGNWENLQKFVKVLDGQKNPYERYFFQAILDIKNDKYNEAQKHID
RAREVLDPKITSLLGESYNRAYILIQEMQNLRELEEIIEYKQPSTDFSRKKHLYLLWCNR
LEYQPSHDLEQWQKSLNIRNLVIDRSEEIDYYLKFAKLAQNNGNNDLGQRVLLNLKNELI
KTKAEKSLKLTNQLAKVEFAIQQTVFISGKHSEAIQNLKKLLRDKEDMDPQIKSDCELKL
GQWHYEQQDFKKANLGEEDYQIILQSCEKATTIHHNNQDAWHFYSQMNYEACIYYSKRLN
EEFQQMSENPAQSHQTNIFDDFQPQTAFQIQQLQAHATLGQKQLGQKYVYHVVCAIKGLV
QILSLSDQMYFSDQTKTLQNTLRLLKLWFRHGNLIEIEQIIRNGFEKIDLKIWIDVIPQL
LARVDIKDHIIRKSLIDLLERISQKFPQALIYSLSVLQKSKTIERRKAADQLIEKLKLKQ
PILIEQATMISDELIRCAIVHAEIWNEAIEEASRIYFGQNDAKAMINYLAPHHKMMEALP
ETMNEIAFYQGYASDLQEAEGWCKRYQQTKNQTEINQAWDIYLNVFRKISGKLKEVQFYE
LKNVAPKLLSSENLDIAVPGTFKSDRKIVKISKFASVLPVLSSKQHPRKMQIYGSDGKEY
MFLLKGHEDIRQDERVMQLFGLVNTLLTIDPQTSKKDLSIRRYPVIPLSQNTGLIGWVPN
CDTLHQLIKDHRTQANIIPNIEYKLMESMCDHFDICPIPNKVEIFRYALDRTMGEDLQKV
LWLKSQNSELWLERRTNYTRSLAVMSMVGYILGLGDRHPSNIMLDRYSGKIIHIDFGDCF
EIAMRREKFPEKIPFRLTRMLIKAMEVSGIEGNFRTTCENTMRVMRASKESLLAILEAFV
YDPLISFKLLNPKILKQNQQKNQDQNGQPQQEEQKNSANNAFAPRSMTAKRGKPGTVRES
IVEQVLERFQKHHGKEEYNQNYAESKFSRKMEEKELMYMIEEEGEDARRQELNQTAEIVI
QRINDKLRGMEFQHGQKMDIERQVDNLIKQAASHENLAQCYIGWCPFW