Identifiers and Description

Gene Model Identifier

Contig18848.0.g106

Standard Name

TOP3c

Aliases

Contig18848_0_g106

Description

DNA topoisomerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004650301.9999565133760522e-166DNA topoisomerase family prote
in
SGDYLR234W1.0003926095686843e-81TOP3 SGDID:S000004224, Chr XII
from 609783-611753, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18848.0.g106(coding)
ATGTATCGTAAAAGATATACAAATCGAGGAGGCGCTGAAGGAAGCTCAAGTGCCGGCAGA
GGTGGTTACGGAAGTTCCAGAGGTGGAAGAGGCGGTAGCAGAGGAGGCTATGGTGGCAAC
TACAATCGAGGTGATGGGTCTTAATCTCAATAAGCATACGTTCCCAGAGATGGTCAATAG
CAGCAACAGTATAATGATCCATACTACGCAGAGGGTGGATCCTATTACGAAGAGGATTAT
GCTGACTATTATGATGAGACCAGTTAACAGCAAAATCAGCAATATTCCAATAAATCACAG
TCATCGTACTAACAACAAAAGCCACAATAGTATGATGATCAGATTTAGTCTTCATCGTCT
CAATACTAACCAAAGTATCAGTCTAAATAGTAGCCACAATAGTAATATCAACACAGACAA
GTCACTACTGTTGAAAAGTAACCACAGCCAGCTTATCAGCAGTCAGAAGATCAAAGAAAA
GAATTTCAATAATCTGCTAAATATCTCCCTAAGAACCAAACCCAGCCATCATATCAAGAA
GAACCAGTAAATTAGGCTGCTTTAACAACTCAATCGAGTGTATTTGTCCCAAAGAAGAAG
CAAGAGGAGGAATAGAAAAGCTATGAGTAATCGAGCTATAATCAAGCAGCTCAGTCTAAG
TATCAACCTAAATATGCACCTAAGGATTAGTATCAGCAGTATTAGGAAGAGGAAACCAAG
GGATATAATTAGAAGTAGAGCTATTAGCAGACTAAATATGCACCAAAGGGTCAAGGTTAT
CAGCAAAAGTCTTATGAAGACACAAGCTATCAAAGAGATTAGCAACCAAAAGCAAGGTCT
AACTTCTAAGATTCTTATTATGAGGAAAATGGTGCTGGGGATTACAGTAATAGAGATACT
AGAGGTGGATATCAAGGCAGAAGCGAAGGCTAAGCCAATAAAAATCAGACTTACTAAGAC
TCATACTATGATGATATCGACTACTACCAGGACTATGGCAGAGAAGATTATCAAAGTCAG
GGAAGAAACACCGGTAATAATGTCGGAGATTCTTACTATATGGACTATGGTGCTGAAAAC
GAAGATTTTGATGAGTAAAATGACAACTACTATGATGAGGTTGACACTCAAGGTTCTAGA
ACCACAAATGCTTCTTTTGTTTCACAAACTAGAAAAATTATAGACACTTAAAAACCTGCT
GAAGACCCTTATAAACAAGCACCTATTAAAGGTAAAGGGGGAGAGCATTAAGATGATCAG
TAGAAGAGTGAAGTGAAAAGAGACGAGAAGAAATATGAAAGAACAGAAGAGAGAAAGGAT
TTCAAAAGAGGAGGTGATAGAGGAACTCAACAGACAAAGAGAGAACCATATTAAAAAGAC
CAAAAGAGATAATAAGAGTAAAAGAGACCTGATTAAAGATATGATGCCTACTAGAGAAGT
AACCAGCAAGAAGATGAAGAAGAGAAAGCGCAGCAGTAGTTATCTCTGAATGAGATATCA
AACATGAACTACGCTTAAGGTAGAAGAGATGAAGGTGTCAGTTCACCCTGTGTAGTCATG
ATGGTCGCAGAAAAGCCATCAATTGCTCTATCAATAGCTGAATCACTCTCAAACAACTAT
GAATAAAAGAAAGGTATTGCAAGGTAAATTCCAGTTTACACATTCAAAGGAAACTTTCAA
GGCAAAACTGCACATTTTAGAGTGACCTCAGTTGCTGGTCATGTTTACAACAGAGATTTC
CCTCTTGATTATTAAGATCGCAGAATGGATCCACTTGCGCTATTTGATGCACCAACTGTA
AGAAAGCTAGATGGTTCATCAAGAACTATAGCAAAACATCTATAAACAGTCAGCTCAGGA
ATTGATTTTATGGTTTTATGGTTAGATTGTGATAAAGAGGGTGAAAACATTTGCTTTGAA
GTTCTTGACATTTGCAGAAAAAATATCCCTAAATCTAAGAGACAAAGGGTATTTAGAGCA
AAATTCTCATCAATTGCTAAGAAGGATATTTAAACTGCTTTTGATACTGTAAAGGCTGAA
CCATCATACAATGAAAGTGTAAGTGTTGATGCTAGACAAGTAATGGATTTAAAAATTGGA
GTTGCCTTCTCAAGATTTTAAACTTAATACTTCCAGTATTTGCTCAGAGGTCAACATGAA
ATAAGAATGATCACTTATGGACCATGTTAAACTCCAACTCTTGGATTTTGTGTGGATCAA
GCTGAAAAGATTAAAAAATTTATCCCAGAACCTTATTGGTCAATTGAAACAGTTATTGCT
GATAAAGATCGTGGAAAGTCTTACTCATTAAAATGGGGTAGAGGAAAGATTTATGATAGA
ACTGTCACAACTATTGTTCATTCAAGAATTGCTTGCTTTGATTCAGCTGAAGTCATTGAT
GTACAAAAGAGTAAGGCTGTTCAAGGAAAACCTTAAGGTCTCAATACAGTTAAGATGCTT
AAAGTTGCTTCAAAGACTTATGGAATGAGTGCTCACGACACCATGAAAACAGCTGAACAT
TTGTATTTGAGAGGCTATATTACTTACCCTCGTACTGAATCAACAACTTATTCTGCCAAC
TTCAACTTTGATGAAATCCTGCAATAGCATTAATAGAACTCAGAATGGGGTTCTTACGCA
ACTAGATTGTTAAATGGAATGATGGTTAAGCCAAAGAAAGGTGTAGATGCTGGCGATCAT
CCACCTATTACTCCTGTTAAAAGTGCTTCTAGAGCTTCACTTGGCGAAAGAGAATGGAAA
CTATACAATTTTATTACAAGAAATTTCTTCGGATCTATCTCCCCAGATGCATCTTACGAT
CAAGTCAAGGTTTTATTCTAAGTAGGAAACAAAGAATCAATAATTGAAAACTTCAAACTC
AAGGGAAATATCTTGGTAGAGCATGGATTCTTGGAAATAATGCCTTGGCTTTTAGCTGCA
GATAAGGAAATTCCAGTATTTAAGATTGGTCAATAAGTTGAAGTGAGATAAATCAAGATC
ACGGAAGGAAAGACTTAAGCACCCGGGTACTTAACTGAAGCCAAATTGATCTCTAGAATG
GAAAAGAATGGAATTGGTACTGATGCTTCAATCCCCACACACATCAACAACATCATCGAG
AGGAAGTTTGTTACAGTGCTCGACCCAGGCAGATAATTGGTACCAACTCCATTAGGTTCT
GCTTTGGTTAAGGGTTATTGTTAAATTGACCCTGAACTTGTTTTACCTTCCATAAGATAA
AACATTGAAAAGAGTTGTGAACTTATCGCTAAGGGGAAAGCAGATTTTGCAAAGATCTTA
GCCCATGTGCTTACATGTTTTAGAAAGAAATTTGAGTTTTTCAGAGCCAACATAAGCAGC
ATGGAAAAGATATTAAGTATGATGCTTAGACATCAGCAGGGAAGACTTGGCAAGGAACTT
ATGCTCACAAATCAAATCCAACTAGATGATGAGTCAAAGAGAACAGCAATTAATTTCTGC
ATCAGATGCTTCACAGGCTATTTGAACATTCAATATCACAATTCAAAGGGGTGGGGCTTG
AAATGCGACTCTTGCACTTTTAGAGTTGGTGTCCTTTCTGGAGCAGCCCGTGTAGTCAAA
GAAGATACTAAATGCGAGGAGTGTGATTCTTATTAAGTTTCTGCTACATACATGAAAGAC
TCACCTTTCCCTGGAAAGCGATCAGAGCACACTGGCTGCTTGTTCTGTGATTCCCTGCTG
AATCAGACTGTCGTCAAGTTCTTCAGCAAAAAGAAGAAGAGCCTTGAGGAAATGACAGAA
GAGGAAAGGAAGGTGTTTGAGGAGAAACGTAAGAAGAAGGAGGAAAAGCAGAAGAAAAAG
GAGGAGAAGAAACTCTAAGAAGCCAAGTCAGCAACTACCAAAACTACTGGTGGAGATGCA
AAAACAGATGATGCAACTAAAAAGAAGAAAAAGAAGAACAAGGCAGGAGGAGCTGGTGGA
CCTAATCAGATGTCTGCTCAGGATATGATGAATGAGTTTATTAAGAAACAGCTTATTGGT
AACAAGTGA


>Contig18848.0.g106(protein)
MYRKRYTNRGGAEGSSSAGRGGYGSSRGGRGGSRGGYGGNYNRGDGSQSQQAYVPRDGQQ
QQQYNDPYYAEGGSYYEEDYADYYDETSQQQNQQYSNKSQSSYQQQKPQQYDDQIQSSSS
QYQPKYQSKQQPQQQYQHRQVTTVEKQPQPAYQQSEDQRKEFQQSAKYLPKNQTQPSYQE
EPVNQAALTTQSSVFVPKKKQEEEQKSYEQSSYNQAAQSKYQPKYAPKDQYQQYQEEETK
GYNQKQSYQQTKYAPKGQGYQQKSYEDTSYQRDQQPKARSNFQDSYYEENGAGDYSNRDT
RGGYQGRSEGQANKNQTYQDSYYDDIDYYQDYGREDYQSQGRNTGNNVGDSYYMDYGAEN
EDFDEQNDNYYDEVDTQGSRTTNASFVSQTRKIIDTQKPAEDPYKQAPIKGKGGEHQDDQ
QKSEVKRDEKKYERTEERKDFKRGGDRGTQQTKREPYQKDQKRQQEQKRPDQRYDAYQRS
NQQEDEEEKAQQQLSLNEISNMNYAQGRRDEGVSSPCVVMMVAEKPSIALSIAESLSNNY
EQKKGIARQIPVYTFKGNFQGKTAHFRVTSVAGHVYNRDFPLDYQDRRMDPLALFDAPTV
RKLDGSSRTIAKHLQTVSSGIDFMVLWLDCDKEGENICFEVLDICRKNIPKSKRQRVFRA
KFSSIAKKDIQTAFDTVKAEPSYNESVSVDARQVMDLKIGVAFSRFQTQYFQYLLRGQHE
IRMITYGPCQTPTLGFCVDQAEKIKKFIPEPYWSIETVIADKDRGKSYSLKWGRGKIYDR
TVTTIVHSRIACFDSAEVIDVQKSKAVQGKPQGLNTVKMLKVASKTYGMSAHDTMKTAEH
LYLRGYITYPRTESTTYSANFNFDEILQQHQQNSEWGSYATRLLNGMMVKPKKGVDAGDH
PPITPVKSASRASLGEREWKLYNFITRNFFGSISPDASYDQVKVLFQVGNKESIIENFKL
KGNILVEHGFLEIMPWLLAADKEIPVFKIGQQVEVRQIKITEGKTQAPGYLTEAKLISRM
EKNGIGTDASIPTHINNIIERKFVTVLDPGRQLVPTPLGSALVKGYCQIDPELVLPSIRQ
NIEKSCELIAKGKADFAKILAHVLTCFRKKFEFFRANISSMEKILSMMLRHQQGRLGKEL
MLTNQIQLDDESKRTAINFCIRCFTGYLNIQYHNSKGWGLKCDSCTFRVGVLSGAARVVK
EDTKCEECDSYQVSATYMKDSPFPGKRSEHTGCLFCDSLLNQTVVKFFSKKKKSLEEMTE
EERKVFEEKRKKKEEKQKKKEEKKLQEAKSATTKTTGGDAKTDDATKKKKKKNKAGGAGG
PNQMSAQDMMNEFIKKQLIGNK