Identifiers and Description

Gene Model Identifier

Contig14889.0.g61

Standard Name

TOP3b

Aliases

Contig14889_0_g61

Description

DNA topoisomerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002161402.0007442334946695e-153DNA topoisomerase family prote
in
SGDYLR234W4.001028812851342e-124TOP3 SGDID:S000004224, Chr XII
from 609783-611753, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14889.0.g61(coding)
ATGAAGAGAAAAGTTGCACTTTGTGTTGCGGAGAAACCAACCGTCGCCAAATCTGTCTCA
GAGTTCCTTTCAAGAAACAGATTCCAGAAGTTCAATTCATTGAGTAAATTCAACCCCGTT
TTTGAGTTTGATTATATGATAGGCAATCAACCTTATCTCTTGAGAGTCACTTCTGTCCTT
GGACATGTAATGTCTTATAAATTTCCAGATTCTTGTAAGAACTGGCAAAACACAAATTAT
GACTAGCTATATGAAATTGATTTGGAGAAATACGTGATAGAAAACAACGTTTAAGTTGTG
AAAAATGTGCAGGCAGCATGTAGAGATGTTGATGAACTGATTTTATGGCTAGATTGTGAT
AGGGAAGGAGAGGCTATTGCTTTTGATGTCATAGATATTTGTGTCAAAGTTAACAGGAGA
TTGAAAGTGCTGAGAGCTCATTTTTCAGCATTAACCAGAGAAGACATAGAAAGAGCTGTT
CAAAATCTAGTACCACCTAACTAGAATTTAAGTGATGCTGTGAGAGTCAGATAGGAGATT
GATTTGAGAATAGGAGCAAGTTTTACTAGACTTCAAACCCTCAATTTCAGGGACATCATG
CTTGGAAACTAGCAAGCTTAATAGCTCGTTTTGAGTTATGGTCCGTGCTAATTCCCAACT
CTCGGCTTCATCGTTGAAAGATTCAAGCATATAAGGGATTTTAAAGCTGAAAAGTTTTGG
TAGTTAAATCTCAAATTGTTAAAAAGAAGTAACGATGGAAAATTGGATGAGGTCAACTTT
GGATGGGAAAGAGATAGAGTTTATGACAAAATGACATGCTTAGCGCTCTATGAAAGATGT
TTGGATAGTGGAAGAGCTAAAATAAGCGAAATTAATAAGTCTAGGAGGACTAGAGGAAGA
CCTAATCCCTTGAATACGATTGAAGCTTAAAAACTGATTTCTAGGAAACTAAAAATTGCA
TCAGCTTAAGCTATGGAAATTATGGAGAAGTTATATCAAAGAGGTATCCTGTCATATCCA
CGTACAGAGACTAATACTTTTAATCCAACTATTAATCTCAGGAATATTGTGAATGAACTG
TGTAAAAGTGAAGTCTTCGGGGATTTTGCTTAAAGAATTAGTGATGGAAGTATGTGGGGT
GGTCCTAAAAATGGAAAGTAAGATGATAAAGCGCATCCACCTATTCATCCAGTCAAATTT
GCAAGCAAGTAAGATCTAGGCTTTGATGAATGGAGAGTATATGAACTAGTAGCAAGGCAT
TTCTTAGCTACCATTTCAAAAGATGCGATAGGAGCTGAAACATGCATCGAGGTTTCTTGT
GGTGGTGAGCAATTCTAAACGAAAGGCCTGATCATCGAAGAATAGAATTGGCTTGAAGTC
TTCCCCTATGAGAAATGGTCAGACTCTTATTTACCACAATTAAACAAAGGTGAATCATTT
GAAGTTAACAATTAAAATCTTAAGATACAGGATGGAGAAACTAGACCACCTCCCTTGCTA
ACTGAAGCTGACTTAATCACTAAGATGGATTAAAATGGTATTGGTACTGATGCCACTATT
CACGAGCATATCAAACATATTCAAGAGAGACAATATGCATATAAGCAAGGACAAACCTTT
CTTCCTAGTCCATTAGGAACAAACTTGGTGGAAGCTTATGAGCACCTTGGTATAGAACTG
TACAAACCATATTTAAGAGCTTAAATGGAAAAAGACATGAAGATGATAGCAGAAGGAATT
AAGTCTAAAGATTAAGTACTTCGAGACTGTGTCAATGAAATGAGGCGAATATTCAACAGA
GTAAAAGATTCAACTCAATAAATGAAAGCATTTCTAATTGATAGAATGTAGAAAAGTCTC
AATTAAAATAATAATAACAACAATAATGGTGGCGGTGGAGGAGGAGGTTAGTAAATAAGA
TCAATAGCAGATTAACCAGCTGCAGGTGGAGGAGGGTAAAGATAAGCAAATTATAGAAAT
CGAGATGAAGAATAGAAAGGATAATCTTAAAGTAACAATTAATAAGGCCCTGCTAATCCA
CAGTTGAACCTTTAAAACACTGAATTTGCTACTTGTCCTTAATGTAAACGCAGTAAACTA
AAAGTTAAGACTTCAAGAACAGGTTCATTATTTATCGCCTGCACAGGTTATCCTGAATGT
AAGATGACTATGTAGCTACCTAAAGGACTGGAGAATATCACAATGACAGATGAGTCTTGT
GTGGAATGCGGTAGAATTTAGAAATAAAAAGTGCAGAAATTCAAATTGGATTTTGTCACA
GAATACGTGAATGAGTCTATGCAAGAAGTTTTACTCTTCGATGATAATACTTCAGGAGTT
TTTTGCGTGATGTAGGGGTGTGATCCATCCTATAAAATATTGGTGGATGCAACTTTTGGC
TTAGCAAATAAACGTAATTTTGACAATGCTTTTCAGAAGAATACAAACGGAGTTCCAAAT
TATTACTACTAGAAACCCTAAACTTTTCAAAATAATCAACAACCAGCAAACAAAAATAAC
TATAACAATAATCAAAATAATAATAATGCTGCCTAGAAAAGAAGGAAAATTGATAAGAAT
TAATTCTAGTAAGTACCTGATAGTGGAGAAGGCTTTTAATCATACAATAGCAATCCCTCA
CCTGTTAATAATTGGTAAGACTGGAAAAACAAAGAAAATAAGAATAATTCCTATAACAAC
AATAGAAACAACAACTACAACAATGGAAATGGAGGTTACAATAATGCTGCTGCAAGAGGT
GGTGGTGCAGCTGCTGGTGGAGATGGAGAAAAAGATGGTTGTAATTTATGTGGTAAAAAG
AGACATTTTAAGACTAGTCAATGTCCTAACAATAAAAATAGGCAATGA


>Contig14889.0.g61(protein)
MKRKVALCVAEKPTVAKSVSEFLSRNRFQKFNSLSKFNPVFEFDYMIGNQPYLLRVTSVL
GHVMSYKFPDSCKNWQNTNYDQLYEIDLEKYVIENNVQVVKNVQAACRDVDELILWLDCD
REGEAIAFDVIDICVKVNRRLKVLRAHFSALTREDIERAVQNLVPPNQNLSDAVRVRQEI
DLRIGASFTRLQTLNFRDIMLGNQQAQQLVLSYGPCQFPTLGFIVERFKHIRDFKAEKFW
QLNLKLLKRSNDGKLDEVNFGWERDRVYDKMTCLALYERCLDSGRAKISEINKSRRTRGR
PNPLNTIEAQKLISRKLKIASAQAMEIMEKLYQRGILSYPRTETNTFNPTINLRNIVNEL
CKSEVFGDFAQRISDGSMWGGPKNGKQDDKAHPPIHPVKFASKQDLGFDEWRVYELVARH
FLATISKDAIGAETCIEVSCGGEQFQTKGLIIEEQNWLEVFPYEKWSDSYLPQLNKGESF
EVNNQNLKIQDGETRPPPLLTEADLITKMDQNGIGTDATIHEHIKHIQERQYAYKQGQTF
LPSPLGTNLVEAYEHLGIELYKPYLRAQMEKDMKMIAEGIKSKDQVLRDCVNEMRRIFNR
VKDSTQQMKAFLIDRMQKSLNQNNNNNNNGGGGGGGQQIRSIADQPAAGGGGQRQANYRN
RDEEQKGQSQSNNQQGPANPQLNLQNTEFATCPQCKRSKLKVKTSRTGSLFIACTGYPEC
KMTMQLPKGLENITMTDESCVECGRIQKQKVQKFKLDFVTEYVNESMQEVLLFDDNTSGV
FCVMQGCDPSYKILVDATFGLANKRNFDNAFQKNTNGVPNYYYQKPQTFQNNQQPANKNN
YNNNQNNNNAAQKRRKIDKNQFQQVPDSGEGFQSYNSNPSPVNNWQDWKNKENKNNSYNN
NRNNNYNNGNGGYNNAAARGGGAAAGGDGEKDGCNLCGKKRHFKTSQCPNNKNRQ