Identifiers and Description

Gene Model Identifier

Contig9663.0.1.g51

Standard Name

TOP3a

Aliases

Contig9663_0_1_g51

Description

DNA topoisomerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01131 ) DNA topoisomerase
  • ( pfam01751 ) Toprim domain
  • ( pfam01396 ) Topoisomerase DNA binding C4 zinc finger
  • ( pfam13720 ) Udp N-acetylglucosamine O-acyltransferase; Domain 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002161405.0000898401533074e-117DNA topoisomerase family prote
in
SGDYLR234W1.0000943968537097e-101TOP3 SGDID:S000004224, Chr XII
from 609783-611753, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9663.0.1.g51(coding)
ATGACCTCAGTTTCAGGGCATTTAATGAGAATGAAATTTCCCATAGAAAATAAGATATGG
ATTGATTCTAAAATCAAAGATCTATATAGAATGCCAGTTGTTAAGGATTTAATTGATGGA
AATGCTAGAGTTCTTTAGAACTTGCATGAAATGAGCTAAGATGTTGAGGAATTGCATCTT
TGGCTTGATTGTGATAGAGAAGGAGAAGCAATTGCATTTGATGTTGCTGATATGTGTAAA
CAAGTAAATAAATACATGCTAGTTAAACGTGCCCATTTTTCAGCTCTGACATCTTAAGAT
GTAAATAAAGCTGCTCAAAATCTACAAGAACCTAACAAAAACTTAGCTGATGCAGTGAAA
GCGAGATAAGAAATTGACTTGAGAATTGGGGCAAGTTTCACATAGCTGCAAACTTTGAGC
TTTAAAGATGTTTTATTTAAGAATAGTACTTCTGGCAACAAGATCTTAAGCTATGGTCCC
TGCTAATTTCCCACCTTAGGTTTTGTTGTTGAGAGAGCTAACAAAATTAAGAATTTCAAA
TCAGAAATAACATGGAGGTTAGAATTAGTTCATTCTTATAATACCAAAGAAGAAGGCAGT
GAAAACACGACTAAACAAGTTATTAAATTTATATCAACTAGAGAAAAGGAACTTGATAAG
AAAATTATAGAAGATTTATATAGTAAGATTAAAGGGATGAATCCAGCTGTTATTGATGTT
ACAAAAACAGAAAAGTATAGACCCAGACCAACTCCTCTTAATACAATTGAAGCCTAAAAG
TTAATTTCAAAAAAGTTAGGTTTTTCATCAGATCATGCAATGGAATACATGGAGGATTTA
TATAGAAAAGCTTATATATCTTATCCAAGAACAGAGACAAATGTGTACCATCCAACTATA
AATTTGCGAAGGATTATTCAAGAGTTGAATAATGATAAGGATTATTCAGGGTTCACAAAG
AAATTACTTGAATTAAATAATTATGGAGGGCCCAGAAATGGAAAGTAAGATGATAAGGCC
CATCCTCCCATTCATCCTGTTAGATTTATGAAAGAAGAAGATAAAGTCAATTTACCGCCT
AATCAAGTGAAAGTATATGACATGATCTGCAGACATTTCTTAGCTTCAGTTTCGAAAGAC
GCCGTAGCTTAGGAAACTGTTGTTAAAATATAAATAGGAGAGGAGTAACTTTAAACTTAA
GGTCTTATTGTCGAGAAAAAAAATTATCTTGAAATCTTTCCATTCGATACTTGGGATTCC
ACCCTTTTGCCAGACTTTAAAGTTGGAGAATAAATCACTTATGACTCCTTGAAAGTAGCA
AAAACTACGACTAAGCCTCCTTAATACTTGTCTGAATCTGATTTAATAGATACTATGGAC
TAAAATGGTATAGGTACTGATGCCACTATTCATGAACACATTAAAAAGATTTAAGAGCGA
TAGTATGCCATGGTTCAAGGAAAAAAGTTCAAGCCCACTTTGCTTGGTCAGTCATTGATT
GATGCTTATGAAGAAATCGGGGTAGATATACATAAACCATACTTAAGAGCTTAAATGGAG
AGAGAAATGAGATTGATTGCTGAGGGCAAAAAGTCTAAAGATGAATTTCTAAAAGAAACA
TTAACTCAAATGGAGGGTGTCTATGACTAAGTTAGTGGAAAAGTGGATCAAATTAAGAAT
TACCTTCAGGTTAATTATAAGCAGCAATTTGATGATATGTATACATTAGATGAAAAAGAG
GGAGTTTTCAGATTTTCAGGTGATTTAGGAGATTCCTAAAACTTAAATTTTAATTAGGAA
AAAAAATAACAGGAAATAGTGAAACAAGTTTTAGGGGAAAACTCTTAAGAACGCGGAAAT
AAAAACTCAATAGCTAACACTAAAATCTGCAAGTGCTACAAATGCAATAAAAATGATATG
GTAATGATGATTAGTGGGAAGACTGGTAATCCCTTTTTTGGTTGCTAAGGTTTCCCTAAG
TGTATTAATCCTCTACCAGTACCTAGGTCTATTTTAAAGGCAGAAGTATCAAATGAAAGT
TGCCCATCCTGTTTTGCACTTGGTAGGGATATAAAGAAAGTGAAATTCTTCTATGATAAA
GAGAAGTTAACTTAAGTTATGAAAGACACTCTCTTAACTGAAGATCCTAAAACCGGGTAA
TATCATGGTACATTTTGCGTTTACAGATCAAAGGAATCATATTGTGATATTAACTATGAA
CTTTTATTTAGAAGTAGCACAAAAATTAAACAACATGTTAAAAAGATAGCGAAAGAATAA
GAAGAAAGTGAAAAGAAATTAATGCTTCAAGAGTAGAAAAAATAACTTAAAACTTAAAAA
AGCGAGTAAAAAGTAAAAACTGTGAAAGAATCGAATGCTCCTAAAACAGTGAAAGGAATG
GAGAATATTAAAAAATTAGAAAAGAAGAAAGCTAAGAGAGCATTATAAAAGTAATAAGCT
AAGTTAGAAAATGACAAATCAATAATCATTAACAAGAAAGAAAGTAAAGATAAACTCAGA
GAGCTGATTGAATCTTAATTGGAGAAAGATTAGCAAACTTAACCATAAAGTGAAAAAATT
GTAAAACCTACAGAGAGACAGGGTTGTGGGGTTTGCGGTAAGAAAAGGCATTCAAAAGAT
GATTAATGCGAAGCATTCTTAAAGAAAAAGCTGATGAAAGAATGA


>Contig9663.0.1.g51(protein)
MTSVSGHLMRMKFPIENKIWIDSKIKDLYRMPVVKDLIDGNARVLQNLHEMSQDVEELHL
WLDCDREGEAIAFDVADMCKQVNKYMLVKRAHFSALTSQDVNKAAQNLQEPNKNLADAVK
ARQEIDLRIGASFTQLQTLSFKDVLFKNSTSGNKILSYGPCQFPTLGFVVERANKIKNFK
SEITWRLELVHSYNTKEEGSENTTKQVIKFISTREKELDKKIIEDLYSKIKGMNPAVIDV
TKTEKYRPRPTPLNTIEAQKLISKKLGFSSDHAMEYMEDLYRKAYISYPRTETNVYHPTI
NLRRIIQELNNDKDYSGFTKKLLELNNYGGPRNGKQDDKAHPPIHPVRFMKEEDKVNLPP
NQVKVYDMICRHFLASVSKDAVAQETVVKIQIGEEQLQTQGLIVEKKNYLEIFPFDTWDS
TLLPDFKVGEQITYDSLKVAKTTTKPPQYLSESDLIDTMDQNGIGTDATIHEHIKKIQER
QYAMVQGKKFKPTLLGQSLIDAYEEIGVDIHKPYLRAQMEREMRLIAEGKKSKDEFLKET
LTQMEGVYDQVSGKVDQIKNYLQVNYKQQFDDMYTLDEKEGVFRFSGDLGDSQNLNFNQE
KKQQEIVKQVLGENSQERGNKNSIANTKICKCYKCNKNDMVMMISGKTGNPFFGCQGFPK
CINPLPVPRSILKAEVSNESCPSCFALGRDIKKVKFFYDKEKLTQVMKDTLLTEDPKTGQ
YHGTFCVYRSKESYCDINYELLFRSSTKIKQHVKKIAKEQEESEKKLMLQEQKKQLKTQK
SEQKVKTVKESNAPKTVKGMENIKKLEKKKAKRALQKQQAKLENDKSIIINKKESKDKLR
ELIESQLEKDQQTQPQSEKIVKPTERQGCGVCGKKRHSKDDQCEAFLKKKLMKE