Identifiers and Description

Gene Model Identifier

Contig14442.0.g108

Standard Name

TOP2b

Aliases

Contig14442_0_g108

Description

DNA gyrase/topoisomerase IV, subunit A

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004567509.997093137033517e-262DNA gyrase/topoisomerase IV, A
subunit family...
SGDYNL088W9.997093137033517e-262TOP2 SGDID:S000005032, Chr XIV
from 457704-461990, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14442.0.g108(coding)
ATGTCAGGAAAGAAGTCTAACTCAAACAAACAAGACGCCATTGAAGAAATCTATCAGAAG
AAGACACAGCTTGAGCATATCTTGCTGAGGCCAGATACTTACATTGGCAGCATAGAAATG
TATCAACAATATTTGTGGGTTTATGATAAGGACAACGATAGAATCGATTACAAGCAAGTT
TAGTATGTCCCTGGTCTCTACAAGATCTTTGACGAAATCTTAGTAAATGCAGCTGACAAT
TTCTAAAATGATCCAACGATGAACTTGATCAAAGTTGAAATTGATCCAGAGCAAAACAAA
ATTTAAGTTTGGAATAATGGCAAAGGTATCCCAGTGCAGATACACAAGGTACATAATTGC
TATGTCCCTGATATGATTTTTGGTTAACTGCTGACTTCCTCAAATTACAACGACAACAAG
AAGAAAGTGACAGGAGGCAGAAATGGTTTTGGAGCCAAACTAGCAAACATTTTCTCTAAC
AAATTCATAGTGGAGACTGCTGACTCAAAGAACAAAAAGTGCTACAAATAAGTTTGGAAG
AATAATATGAGCATCAGAGAGGAACCTAAAATCACTGATAACAGCAAGAATGATGACTAC
ACATGTGTAACATTTTACCCAGACTTACGAAGATTGGGGATGGAAGTGCTTGACAATGAC
ATTGTGAGTTTAATGACCAAGAGAGTTTATGATATGGCTGGCTGTACACCTGCGAACGTA
AGAGTCAAGCTAAATGGTAAAAGCATAGAAATTAAGAATTTCAACACTTACTGCGACCTC
TATCTAAAGAATGATGAAACCAAGCAGCTTCCAAAAATTGTAGAGAAGTATGATTAAGGT
GCTAGATGGGAGATTATTGCCTCACTTTCAGATGGACAGTTTCAATAGGTTTCATTCGTT
AATTCTATTTGCACTATTAAAGGAGGATCACATGTGAACTACATAGCTGACTAGATAGTT
GAGAAAATCTCTGAAGTCCTCAAGAAGAAGCACAAGGGTGTTGACATTAAACCTCACCAA
ATCAAATCCAATCTCTGGCTCTTCGTTAATTGCTTAATTGAAAACCCTGCTTTTGACTCA
CAAACCAAGGAAACATTGACTACTAAGCCAAATAGCTTTGGGTCTACCTGCACTCTCACT
GAGAAATTCCTCAAGGACATACTGGCCTCTGGTATCATAGAGTCAATTGTGTCTGTAGCT
AAAGCCAAAGAAGAAGCTAAGCTCGTGAGAAACCTGAATCAGGGCAAGAAGAAATCGAAG
TTGATGGGCATACCTAAGCTTGAGGATGCAAATGACGCTGGTACTAAACATGCAAGAGAC
TGCACAATTATTCTTACTGAGGGAGACTCAGCTAAAAGTTTGGCACTGGCTGGCATTGAG
GTGGTCGGCAGAGATAAGTTTGGAGTCTTTCCACTGAGAGGTAAATTCCTGAATGTGCGT
GAGGCAGGTTCTAAGCAAATAATGGATAACCCTGAAATTCAAAACTTGATCAAAATTATC
GGGTTAAAGATTGGCAAGAAGTATGAAGTTGATGCAGACTTAAATGACTTGAGATATGGC
AAACTTATGATTATGACAGATTAAGATCACGATGGCTCACATATCAAAGGTCTGCTGATT
AACTTCATTCACTTCTTCTGGCCAACTCTGATGAGAAACAACGGTTTCGTGCGAGAATTC
GTAACCCCAATTATCAAAGCCACCAAAGGCAATGAAGTCTATTCTTTCTTCACCATCCCA
GAGTACGAGCAGTGGGCAGACGGAAGAAACTTGAAAGGATGGAAGATCAAGTATTACAAA
GGACTTGGTACCTCCTCTGCGAAGGAGGCCAAGGAATATTTCTCAGCCATTGATAATCAT
CAAATTGAATTTGAATACGTTGACAACGAAGATGAAGAAGTCATTGATCTTGCTTTCAAC
AAGAAACTAGCAGACAAGAGAAAGGACTGGTTGACTACTTATAGAACAGATTTGTATGTG
GATCATTCTCAGACACACTTGAGATACAAAGATTTCGTAAACAAAGAACTTATTCTATTC
TCAGTTGCTGATTGTCTAAGATCCATTCCAAATCTTTGTGATGGTTTAAAGCCTGGTCAG
AGAAAGATTCTATTTTGTGTATTTAAGAAGAAGCTCAAGGATGAGATAAAGGTGGCCCAA
CTTGTTGGTTATGTTGGAGAAAACTCAGCTTATCATCATGGAGAGCAATCACTATGTCAG
ACTATCATAACTATGGCTCAGAATTTCGTGGGATCAAACAACATTAACTTACTGCTTCCT
CTGGGTTAATTCGGTACAAGAAACTAAGGTGGCAAAGAGGCAGCTAGTCCTCGTTATATT
TTCACCAATTTGAACCCAGTTACAAGAACTATCTTCCCTCAAGAAGATGACGCTGTGCTC
AACTATTTAGAGGAAGAAGGTCAGAGCATTGAACCTGACTACTATCTCCCAATCATTCCA
ATGTGTTTGGTTAACGGAGCAGAGGGTATTGGTACTGGTTGGTCAACCTTCATTCCATGT
CACAACCCTAAAGATATAGTTGACAACTTGAAAAGAATGATGAAGGGCGAGCCATATCAA
ACAATGAGACCTTGGTACAAAGGCTACTTAGGCTCCATTGAAACTCTGTAAGGTGGTAAG
AATGGGTACCTGGTCAGAGGTAACTATGAGGTACTAGATGATGGTATGAGTTTGGTAATC
ACTGAACTGCCAATTGGTAAATGGACAAGAGACTACAAAACCTTCCTTGAAGAACTAGCT
GATGTAAAGAACGGGGAAATCGTTGACGAAATTAGAGAACTGCACACTGAAAACAGAGTG
CATTTCATAGTAAAATGTAATCCAGGCAAGCTTCAAGATATTGAGGCTAAAGAAGGCATT
GAAAAGAAGTTTAAGTTAAGCACCACTTTATCAAGTGCAAACTATGTTCTCTTTGATTAC
TAAGGCAAAATAAGGAAGTATGCCGGAGAAGAATACATAGTCCGTGAGTTTTTCGGGCTT
CGTGAAGCTTTGTATCACCGTAGAAAAGACTACATCCTTGCCAGACTTAGAAAAGAATTT
GAAACTATTGAGAATAAGATGAGATTCATCCTTGCAATCATCAATGAAGATATCAAGATC
AATAGAGTCAAGAAGAAGATAATTGTTGCAAAACTGAGAGAGATGGGTTTCAAAACAGCC
TCAGAAATAAACGACATTCTACCAGAGAAGAAGCGTATAACCTTGAGATAAGATAGTGAA
GAGCAATCTGAAAACATGGAGAATGCTCAAATCTAAGAAGAGATTGTGGCACCAGGTGAA
CTATCTTTAAGGGAATATGACTATCTTCTTAACATGCCAGTTATGTCTTTGACTGATGAG
AAAGTTGATGAACTCGATAGGCAATTGAAGGAGAAGAAAGCCGAGTATGATAAGCTCTTC
GCCATGCACATCTTTGAATTATGGGAGAATGACCTAGATAACTTCCTCATTGCTCTGGAG
AAGCAAAATGAACTTGAAGAGAAAGATAGAAATGCATATGGAGCTTCAAACGGAGGTTCA
GGCAAGAGAAAAGGAGGCAAGAAAGGCACAACAGCAGGAGGTGGCAAAGATAAAGAGAAT
GGTAGAACAGCTAGAGGCTAAGGGAATGCAGGCGGTGCTAGAGGAGGCAGAAAACCAAAT
AATGACGCCTCTCATTCCAGGAAACCACAAACTAAGCAGGAGCCATAGATTGAACCAGAT
TTTAACATACCTTTGAACGAGAGATTAAGATTAAGAGCTCTGGCAGCTCCTTCGCAAGGT
CCCTCTGCCAAACTCTAACCCTAATAGTCAATTTTAAAGGCTTTGGATCCCCAAGAAAGA
GAAGCAATGTAGACTGGCACTAGAAAACGAAGAGCCCCAGCTGACTCAAGCAATTCCAGT
TCAAGATCAAAGAACATTCAGAGAAAGAAAGAGGCCCCCGCTAAAACCACCACTAACAAT
AGCAAACCCCCGAAACAACAACAATTAAATCTGCAGAGAGTGCAGGCACCACCCAAGAAA
ACCATGGCTGAGGAGGTTGAAGAGAGCAGTGACATGCTCATGCAGTTTCAACAGATGAAG
AGGAACATCCCAACTAGGAACAGAGGAAACGGTGCAGCAGGACAGAGAAGAGTGGTGAAG
GATGATGATAGTGATGAGTTGTCTGATGGTGAATTCGATGACGATGATGATGAGAGCGAT
TTCGGAATTGGAGGCGATGATGACTCCATCTGA


>Contig14442.0.g108(protein)
MSGKKSNSNKQDAIEEIYQKKTQLEHILLRPDTYIGSIEMYQQYLWVYDKDNDRIDYKQV
QYVPGLYKIFDEILVNAADNFQNDPTMNLIKVEIDPEQNKIQVWNNGKGIPVQIHKVHNC
YVPDMIFGQLLTSSNYNDNKKKVTGGRNGFGAKLANIFSNKFIVETADSKNKKCYKQVWK
NNMSIREEPKITDNSKNDDYTCVTFYPDLRRLGMEVLDNDIVSLMTKRVYDMAGCTPANV
RVKLNGKSIEIKNFNTYCDLYLKNDETKQLPKIVEKYDQGARWEIIASLSDGQFQQVSFV
NSICTIKGGSHVNYIADQIVEKISEVLKKKHKGVDIKPHQIKSNLWLFVNCLIENPAFDS
QTKETLTTKPNSFGSTCTLTEKFLKDILASGIIESIVSVAKAKEEAKLVRNLNQGKKKSK
LMGIPKLEDANDAGTKHARDCTIILTEGDSAKSLALAGIEVVGRDKFGVFPLRGKFLNVR
EAGSKQIMDNPEIQNLIKIIGLKIGKKYEVDADLNDLRYGKLMIMTDQDHDGSHIKGLLI
NFIHFFWPTLMRNNGFVREFVTPIIKATKGNEVYSFFTIPEYEQWADGRNLKGWKIKYYK
GLGTSSAKEAKEYFSAIDNHQIEFEYVDNEDEEVIDLAFNKKLADKRKDWLTTYRTDLYV
DHSQTHLRYKDFVNKELILFSVADCLRSIPNLCDGLKPGQRKILFCVFKKKLKDEIKVAQ
LVGYVGENSAYHHGEQSLCQTIITMAQNFVGSNNINLLLPLGQFGTRNQGGKEAASPRYI
FTNLNPVTRTIFPQEDDAVLNYLEEEGQSIEPDYYLPIIPMCLVNGAEGIGTGWSTFIPC
HNPKDIVDNLKRMMKGEPYQTMRPWYKGYLGSIETLQGGKNGYLVRGNYEVLDDGMSLVI
TELPIGKWTRDYKTFLEELADVKNGEIVDEIRELHTENRVHFIVKCNPGKLQDIEAKEGI
EKKFKLSTTLSSANYVLFDYQGKIRKYAGEEYIVREFFGLREALYHRRKDYILARLRKEF
ETIENKMRFILAIINEDIKINRVKKKIIVAKLREMGFKTASEINDILPEKKRITLRQDSE
EQSENMENAQIQEEIVAPGELSLREYDYLLNMPVMSLTDEKVDELDRQLKEKKAEYDKLF
AMHIFELWENDLDNFLIALEKQNELEEKDRNAYGASNGGSGKRKGGKKGTTAGGGKDKEN
GRTARGQGNAGGARGGRKPNNDASHSRKPQTKQEPQIEPDFNIPLNERLRLRALAAPSQG
PSAKLQPQQSILKALDPQEREAMQTGTRKRRAPADSSNSSSRSKNIQRKKEAPAKTTTNN
SKPPKQQQLNLQRVQAPPKKTMAEEVEESSDMLMQFQQMKRNIPTRNRGNGAAGQRRVVK
DDDSDELSDGEFDDDDDESDFGIGGDDDSI