Identifiers and Description

Gene Model Identifier

Contig22688.0.g88

Standard Name

TOP2a

Aliases

Contig22688_0_g88

Description

DNA gyrase/topoisomerase IV, subunit A

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004567509.997093137033517e-262DNA gyrase/topoisomerase IV, A
subunit family...
SGDYNL088W9.997093137033517e-262TOP2 SGDID:S000005032, Chr XIV
from 457704-461990, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22688.0.g88(coding)
ATGGTTGAAAAGTCTGTTGAAAAGATTTACCAAAAAAAGACTCAACTTGAGCATGTGCTC
CTAAGACCTGACACTTATGTCGGATCCACCGAAAAAATAGACTAGATCTTGTGGATATTT
GATGAGAAAACAGAGAAATTTAAAGAGAAAAAGATTTCATACACTCCAGCTTTATACAAG
ATTTTTGATGAGGTCTTAGTCAATGCAGCCGATAATTATCAAAGAGACAAAAAAACTTCT
CAGATAAAAGTTAACATCAATCAAGCTAAGAATTCTATCAGTATTTACAATAATGGATCT
ACAGTTCCAGTTGTAATTCACAAGGAGCACAAATGCTATGTTCCTGAGCTAGTTTTTGGT
AAGATTCTTTAAAAGTTACTTATTCACTTAGGTCATTTACTGACTTCTAGTAACTATGAT
GACACTGAGAAGAAAACCACAGGAGGCAGAAATGGATTTGGAGCCAAACTCACTAATATT
TTCTCTAAGAAATTTACAGTTGAGATTGGTGATTCTAAAAATAAGAAGCATTATAAGCAA
GAATTCACAAACAATCTACAAAATGTTGGAGAGCCTACTATCTCACCTTATTCTCCAGAT
TAGAATGATTACATCATTGTGACATTTTAGCCAGACCTTAAGAGATTTGGAATGAAAGAA
TTAGAGAATGATATTGTTGGCTTGCTCAAGAAAAGAGTATATGATTTAGCAGGAACAAGT
CCAAAAAGTGTTAAAGTATATTTGAATGAAAAAAAGTTGGAAATTGAAACATTTGAGCAA
TATGTTGACCTTTATTTTAATAAGACAGTCCCTTAGAAGTTCTATGAGAAATGTGGACCT
AGATGGGAGATATGCGTTGCAGTGCTTGACTTAGATTAATTCTAGTAAGTTAGTTTTGTG
AATAGTATTTGCACGGTAAGAGGAGGGTAGCATGTTAATCACGTTTCTGATCAGATAGTA
AACAATTTGTTGGAAGCAATACAAAAGAAACATAAGAAAATTGAGCTCAAGCCTTTCTAA
ATTAGACAGAATCTATGGGTCTTTATCAATGCTTTAATTGAAAACCCTGCTTTTGATTCT
CAAACTAAGGAAACTTTGACATCTCGGCTAAGTACCTTTGGAAGTAGATGCGACATATCA
GAAAAGTTTCTTTCGAAGATTGCTAAATCTGGTATAATTGAGGATATCGTTGCCAAAGCT
GAAATGAAGGAAGCAATGAAATTGAAGAAAGAATTGGGAACTGGTGTTAAAAAGAAGAAA
CTATTTGGCATTCCTAAACTTGAAGATGCAAATTTGGCTGGTACTTCTGAGTCTGAATCA
TGCATACTTATTTTAACTGAAGGAGATTCTGCAAAATCTCTAGCAATGAGTGGTCTGTAA
GTTGTTGGCAGAGATCGTTTTGGAGTTTTCCCACTAAGAGGAAAATTATTAAATGTAAGA
GATTGCGGTATGAAGTAAATTTTAGATAACGAGGAGATCCAAAATATTATCAAGATACTC
GGGCTATATATGGGTAGATAATATGATGATCTTAAGACATTGCGATATGGATCTATAATG
ATTATGGCAGATTAAGATCATGATGGATCTCATATCAAGGGACTTATCATAAACTTTATA
CATAACTTCTGGCCATCATTGATTAAAAAGTTCCCAACCTTCGTGAAAGAATTTGTCACT
CCAATTATCAAAGCAACTAGCCATAATGAATGCCTTTAGTTCTTTACAATTGCAGAATAT
GAAAAATGGGCTTAATTAAAAGGAACTAATGAACTTAAAAGCTACAGAATAAAGTATTAT
AAAGGTCTAGGTACCTCGACTGCTCTAGAAGCTAAATAGTACTTCCAGAGTATCAAGAAA
CATCAAATTAATTTTTATTACAAAGATGACAAAGATGAAGATAAAATCTTGTTAGCTTTT
AGCAAGACTAAAGCAGATGATAGAAAGAACTGGCTTAGTTAGTTTAATCCCAATATTTAC
GTCGATCACAGCAAGAACAAACTGTGCTATGCAGAGTTTGTCGATCAAGAACTCATTCAT
TTCTCAATAGCTGATAATATGAGGTCTATACCATCTGTGATGGATGGTCTCAAGCCTGGT
TAAAGGAAAATCTTATTCGCTTGTTTTAAGAGAAAATTAAAAGCTGAAATCAAAGTAGCC
TAATTGTCAGGATATATTGCAGAGCACACAGCTTATCATCATGGTGAGATAAGTTTGCAA
ATGACTATAATAAATATGGCATAAGATTTTGTTGGAAGTAACAATCTCAATTTATTGCAA
CCTATTGGTTAATTTGGTACTAGAATGATGGGAGGGAAAGAGTCCGCAAGTCCGAGATAT
ATCTACACAAATTTAACTCCCTTTGCAAGATCCCTATTTAATGAGAACGATGATCCACTG
TTAAAGTATTAAATTGAAGAAGGAATGGGAATTGAGCCTGAATTTTATGTTCCAGTTTTA
CCATTAGTGCTTATTAATGGTGCAGAAGGTATTGGAACAGGTTGGTCAACCTACATTCCA
TGTTTCTCTCCTATTCACATAATTCATAACATTAAGAGGCATCTTGAAGGAAAGCCTTTT
CTAAGAATGCAACCATGGTACAAAGGATTCACTGGACAGATTGAGCCAAAGTAAAATGAT
GAATCAGGACTCTCTTATATTGACAAGGGAAAATTTAAAGTTGACAAAGAGAGAAACAAA
CTTATTATTACTGAATTACCCTTGCAGAAATGGACAAGGGAATACAAAAATTTCTTAGAA
GAGCTTGCTTAAAAGGATGAAATTATTGATATAAAGGAGTTCCATCAAGATAACACAGTC
CATTTTGAAGTTAAATTTAACAGAAGCAAACTAGACATAGGCACTTTGGATGATGATTAA
ATTGAGAAAAAGTTTAAGCTCACTTCTAATCTCAATTGCACAAATTTGGTACTTTTCGAT
AGAAACTGTAAAATCAAGAAATACGAAAATGAATGCTAAATTCTTGAAGAATTCTTTAAT
TACAGACTCAATCTCTATAAGAAAAGGAAGGAGAGTATGCTTAAAATTATCACTGAGCAG
TACGAGAAATTGAGCAACAAATACAGATTTGTTGCATCTATCATAGATGGAAGCCTTGAG
ATCTATAAAAAGAAGAAGGAAGATGTTGTGAAATTACTCAAAGAAAAAGGTTTTAAGACT
TACCAAGAAATTCATGGTCATTAGAAACAAAACTTGCAGTAAGTTGAAAACTAACCTCAA
GAAAAACAAGGCAAAGATGCAAAGAAGAATTTCTAACTTGACAAGAGATAAGACTACAAC
TATCTTCTTAATATGAAGATCTTTTCATTTGTAGAAGACTAACTAGTATTACTTAAAACC
AAGATGAATGAGATTGATGAAAAGAGATAAGATCTGTAAAGGAAAACACCTGAAGATTTA
TGGAGAATAGATCTTGACTAGGTTTAGGCACTTTATGAGGATACCATGTCTAAAACTGAT
AAAATTATCACTTAAGACATCATGAGAATCAAGCACAAAGAATGGGAGGGAGTTCAAGGC
AATTAAATCCAAACAAAAGTTGAGAGAGGAAATGTGCAATAAAATCTCAGAGCAAAAGAT
TTGGAAGAGGAGAATAAGATGGAAATAGATGAAGATCTTACAAAAGAAATTATTATGCCA
AAAGCTGAGCATAGAGTTGTCACTAAGGTGACTTAGAATGGTATTACACCAAAGAGTGCA
AAAGATTCTTCACCTTTACCAAAGTCTACTGTTAGATAAGTGTCTATTAAAAAGTCCACC
GATAAAAAGAGTGTTAAGAGCAAGAATGATAGCGAGAGTGAATCGGAATTCGAGGAAACT
AAATCAATAAAATCGGGTAGAAAACAAAATTCAAAAGCAAAATCAGCAGGGTAATCAAGT
GGTAAAAAGGCTGAGTAAAAGAAAAACTAAAAGAAAAGAAGTAGAAAAAATATTGAAGAT
TCTGAAGATTCTGAATCTTCAGAGGATTCTAATTCAAGTGGCTCCTCTTTGGATGAGTCA
AGTTTTTCTGCTATGAGTGATTCAGATTTTGATAGCAAACCAAAAAGAAATACTAGGTCA
ATGAAAAGCGAACATTCTGGAAGCAAAAACGCTAAAGATTCATTAACAAGAAACTCAAAG
TTAGCTGAGAAAATCAACTCAAAATAGAAAGAGCAAGAGTTGAAGCAATAAAAATCAATC
AATAGCAATAGTTCACCAAAGAAGAAACTTTTAGAGGAAGAAGTCAAACAATCTAGTAAA
TCAGACAATTCACTCTAACAAAAGCCTCAACAGCAAAAGTTAGCATTTTAATAGCAACCT
AAAACTCAAGGAACACTTGATTAACTATTTGACAAGAGCAAACAGGTCTCTTAAGCTATC
GATGAAATCAAGACTGTCAAGAAGGAAGAGCCAAAGAAGGAGGTCTATGAGATGTCAATT
CAAGAAAGAGTTGCTATGCTTAAGTTACAAGGTACATCCTCTTCAGGGAAGTAAAGCTAA
GGAACTGTAGAAGCTGTATCTGTTGCAACTAACTATGTTAAAGCAAATCAAGAAGTCGAT
CTAGATAAGAGTTGGGTAAATATTGGTGAGGATGAGGAAGAAGAGATTCCTATTTCAAGA
ACTAACAACAAAAAGAGAGCAGCTATACTTGATGACGATGAATGA


>Contig22688.0.g88(protein)
MVEKSVEKIYQKKTQLEHVLLRPDTYVGSTEKIDQILWIFDEKTEKFKEKKISYTPALYK
IFDEVLVNAADNYQRDKKTSQIKVNINQAKNSISIYNNGSTVPVVIHKEHKCYVPELVFG
KILQKLLIHLGHLLTSSNYDDTEKKTTGGRNGFGAKLTNIFSKKFTVEIGDSKNKKHYKQ
EFTNNLQNVGEPTISPYSPDQNDYIIVTFQPDLKRFGMKELENDIVGLLKKRVYDLAGTS
PKSVKVYLNEKKLEIETFEQYVDLYFNKTVPQKFYEKCGPRWEICVAVLDLDQFQQVSFV
NSICTVRGGQHVNHVSDQIVNNLLEAIQKKHKKIELKPFQIRQNLWVFINALIENPAFDS
QTKETLTSRLSTFGSRCDISEKFLSKIAKSGIIEDIVAKAEMKEAMKLKKELGTGVKKKK
LFGIPKLEDANLAGTSESESCILILTEGDSAKSLAMSGLQVVGRDRFGVFPLRGKLLNVR
DCGMKQILDNEEIQNIIKILGLYMGRQYDDLKTLRYGSIMIMADQDHDGSHIKGLIINFI
HNFWPSLIKKFPTFVKEFVTPIIKATSHNECLQFFTIAEYEKWAQLKGTNELKSYRIKYY
KGLGTSTALEAKQYFQSIKKHQINFYYKDDKDEDKILLAFSKTKADDRKNWLSQFNPNIY
VDHSKNKLCYAEFVDQELIHFSIADNMRSIPSVMDGLKPGQRKILFACFKRKLKAEIKVA
QLSGYIAEHTAYHHGEISLQMTIINMAQDFVGSNNLNLLQPIGQFGTRMMGGKESASPRY
IYTNLTPFARSLFNENDDPLLKYQIEEGMGIEPEFYVPVLPLVLINGAEGIGTGWSTYIP
CFSPIHIIHNIKRHLEGKPFLRMQPWYKGFTGQIEPKQNDESGLSYIDKGKFKVDKERNK
LIITELPLQKWTREYKNFLEELAQKDEIIDIKEFHQDNTVHFEVKFNRSKLDIGTLDDDQ
IEKKFKLTSNLNCTNLVLFDRNCKIKKYENECQILEEFFNYRLNLYKKRKESMLKIITEQ
YEKLSNKYRFVASIIDGSLEIYKKKKEDVVKLLKEKGFKTYQEIHGHQKQNLQQVENQPQ
EKQGKDAKKNFQLDKRQDYNYLLNMKIFSFVEDQLVLLKTKMNEIDEKRQDLQRKTPEDL
WRIDLDQVQALYEDTMSKTDKIITQDIMRIKHKEWEGVQGNQIQTKVERGNVQQNLRAKD
LEEENKMEIDEDLTKEIIMPKAEHRVVTKVTQNGITPKSAKDSSPLPKSTVRQVSIKKST
DKKSVKSKNDSESESEFEETKSIKSGRKQNSKAKSAGQSSGKKAEQKKNQKKRSRKNIED
SEDSESSEDSNSSGSSLDESSFSAMSDSDFDSKPKRNTRSMKSEHSGSKNAKDSLTRNSK
LAEKINSKQKEQELKQQKSINSNSSPKKKLLEEEVKQSSKSDNSLQQKPQQQKLAFQQQP
KTQGTLDQLFDKSKQVSQAIDEIKTVKKEEPKKEVYEMSIQERVAMLKLQGTSSSGKQSQ
GTVEAVSVATNYVKANQEVDLDKSWVNIGEDEEEEIPISRTNNKKRAAILDDDE