Identifiers and Description

Gene Model Identifier

Contig11896.0.g103

Standard Name

TOP1

Aliases

Contig11896_0_g103

Description

Eukaryotic DNA topoisomerase I, catalytic core

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01028 ) Eukaryotic DNA topoisomerase I, catalytic core
  • ( pfam02919 ) Eukaryotic DNA topoisomerase I, DNA binding fragment
  • ( pfam14370 ) C-terminal topoisomerase domain
  • ( pfam08340 ) Domain of unknown function (DUF1732)
  • ( pfam12311 ) Protein of unknown function (DUF3632)
  • ( pfam07864 ) Protein of unknown function (DUF1651)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012996509.999763672313033e-177Eukaryotic DNA topoisomerase I
, catalytic cor...
SGDYOL006C9.997751616309157e-110TOP1 SGDID:S000005366, Chr XV
from 315387-313078, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11896.0.g103(coding)
ATGTTGCCTTAAAAGAGAAAACCCGCGGGAGATGAAAATTCTCAACTAACTGACTCTTAA
CTACAGAAACCAAGCAAAATTCAGAAAATAAGTGATTCTCAAACTGCAGCTGATTCAATT
CTATAGTCAAAGAGTGTTAATGGAAAAATCAATGAAATCAACAACAAAAATGACAATGAG
GAGTCAGACAATGAGCAAGAAAACAAGAAGATCAAATGGAAATCTCTCGAACATCATGGA
GTGACTTTCTTTGCTGCCTACAAACCTCACTATGTCAAAGTATTACATAAAGGTTAACCT
ATGAGTTTAACTCCAGAGCAAGAAGAAATATGCAATTGGTGGGCTCAAATCATTGATTAA
GACTTTGCCAAGAAGGATATTGTCAGAAAGAATTTTGAAAAATCTTTTATTGAATTATTT
GATGAGGATTAAGGTGTGACATCACTTGATGATTTTGATTTTGCTCCAATTGTCAGGTAT
TTATAAGAATTCAAAGAGTCAAGAAAAAATCGAACTACAGATGAGAAAAAGAGAGAACTT
GAGGAGAGATAAAAGCAAGATGCTTTCTACAAATATTGCTTGATAGACGGTCAATTGGAA
AAGATATCAAACTTTATGGTTGAGCCTCCAGGTATTTTCAGAGGTCGTGGTGATCATCCC
TTGGCTGGAAAACTAAAGTCCAGAATTTTACCTGAAAATGTGCAAATTAACATCGGGCCT
GAAGAACCAATCCCTATTTGCAACATTCCTGGTCACTCTTGGAAGCGAGTTCTCTCAAAT
CCTGAGGCTACATGGCTTAGTCATTTTAAAGATGAAAGGACAGAGAAGAGTAATAACACA
GGAAAATATGTATTCTTGGCTGCTGAGAGTAAACTAAAAGGTGAAAATGATAAGAAAAAG
TATGAAAAGGCAAGAAGACTCAAGCAAAACATCAAAATTATTCAAAGAAACTACGAAGAT
AAGATGAGATCTTAGGATAAAGTTGATTAATAATTAGGAGTCTGTACCTATCTAATTGAT
AAGCTTGCTTTAAGAGTTGGAAATGAAAAGGGAGAAGATGAGGCTGATACAGTTGGTTGC
TGTTCATTAAAAGTCAAGAATGTTCAACTAGAAGCAGACAACAAGATAACTTTGGATTTC
TTGGGAAAAGATTCAATCAGATATCTCAATACTGTTGATGTTACTCCAATTGTTTATCAA
AATATTGAAAACTTTTAAAAAGGCAAAGGCCCAGATGATGAACTTTTCGAAAGAATAAAT
GCATCAAGACTTAATGACTACTTGAAAGAGATGATGGAAGATTTGAGTGCAAAGGTCTTT
CGTACTTATAATGCTTCAGTTACTCTTCAGACCTAACTCTAAGAGCATGATAATTAATTA
TCTGAAGCAGATGTAATTTAAAAGAAAGTAGATTTTTATGAGAATTGCAACAGAGAAGTA
GCCAGACTTTGTAACCATTAAAAAGAAGCTGCAAAGAACCACGATGAGTAAGTTATAAAG
ATGAAGGATGTGCTTGAATAAAAATAATAGAAGCTCAGAAACCTTGAGGCTGAAATGATA
AAAATTAAGAAAGGAAAAGGATCAAGTGACCCTAAAATGCCAAAAACAGCTGAGTAGTGC
AAAATCTAAATTGAAAAGGCAAGAGAGCAATATGAATAACAATTAAGCAGAGTTACCAAG
AAAGAACAAAATAAGAACTATGCTTTGGGAACTAGTAAGATTAATTATATGGATCCAAGA
ATCACCATTAGTTGGTGCAAACACAAGGAAGTTCCAATTGAGAAAATATTTTAACCAACT
CTTGTTAACAAGTTTACATGGGCAATGAACATTGAACCAGGTTGGGAATTCTGA


>Contig11896.0.g103(protein)
MLPQKRKPAGDENSQLTDSQLQKPSKIQKISDSQTAADSILQSKSVNGKINEINNKNDNE
ESDNEQENKKIKWKSLEHHGVTFFAAYKPHYVKVLHKGQPMSLTPEQEEICNWWAQIIDQ
DFAKKDIVRKNFEKSFIELFDEDQGVTSLDDFDFAPIVRYLQEFKESRKNRTTDEKKREL
EERQKQDAFYKYCLIDGQLEKISNFMVEPPGIFRGRGDHPLAGKLKSRILPENVQINIGP
EEPIPICNIPGHSWKRVLSNPEATWLSHFKDERTEKSNNTGKYVFLAAESKLKGENDKKK
YEKARRLKQNIKIIQRNYEDKMRSQDKVDQQLGVCTYLIDKLALRVGNEKGEDEADTVGC
CSLKVKNVQLEADNKITLDFLGKDSIRYLNTVDVTPIVYQNIENFQKGKGPDDELFERIN
ASRLNDYLKEMMEDLSAKVFRTYNASVTLQTQLQEHDNQLSEADVIQKKVDFYENCNREV
ARLCNHQKEAAKNHDEQVIKMKDVLEQKQQKLRNLEAEMIKIKKGKGSSDPKMPKTAEQC
KIQIEKAREQYEQQLSRVTKKEQNKNYALGTSKINYMDPRITISWCKHKEVPIEKIFQPT
LVNKFTWAMNIEPGWEF