Identifiers and Description

Gene Model Identifier

Contig17851.0.g20

Standard Name

TOF1

Aliases

Contig17851_0_g20

Description

Timeless protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000461301.0004137340105782e-93Yip1 domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17851.0.g20(coding)
ATGGAAGATGAGGATGTAGGTGAGAGAAGAATCGATTGTGATGAGGAAAAGAAGCTTTTC
TAGGAACTCCTTTTCTGCATCTAGGGAGTTGGCTCTATTAAAAAGATTAATGGCTATGAT
GTGTATGTCAAGCATGATCATTGTGAAGAGAGTCTAAAAGACATACTATCAAGTGTCAGA
AAGGATGGAGCCAAATATCCTGTGGTGAAGCTGTTCCTTGGATAGTGGGAATTCTTAAAG
AAGGATCTCATCCCACTCTTAGTCTTTCACCATCAAGATAAAAGACTTTCTTTCATTGCT
TGCATGATTATTTTCTTGATAACTCAGATGCCAGATGAAAATTGCACAGATAAAGCTAAG
TACATGGAACACCTCAGATAATACAAAGAATGCTTCATTCAATAAAATGTAATCCAAGTG
CTGATATAACATCTGGCTGATTGCTTGCAAATATAAGAAAGAAACCAAAAGCATGAGTAG
ATGATTGAGTTGATCATTTGCATTTTTAAGCAATTGCTCATCATCCCAGAAGATAACACA
TAGCAATCAAATAATACAAAAAACTTACAAAAAAGATTACTACTTGTGTATGGTGAGGAG
AATGTGCTTGACTCTTTCATTTTTATGACTCAAGAATTCACTCATCCATTTTTCTAAAAG
ATGTCAGTTCATTTCTTAGAAATTTGGTACTAGATCTTTAAAAATTTTACTCCATCACAA
ATTTACAAATTTGAAGATGGAGAGAAGTAAGCTTTAGAAGAGGCAGAAGCAAGAGAAAGA
TCAAAACAAAAAAAACATAATTGGCTTAGAGGTATGAGACATGGTAAATTCGGATCATAG
ATACAGATTTACAGAGATGATGGAAGCTCAGCTATATTTGGGAATATTTACTCTAAAAGT
ATCGATGTAAGTCAGGTCAATACCCATTAAAGGAGGAAAGCACAGCCTAGAATGATAACT
GATCAAAAGAGAATCATTGAAGCACCATAAACGAATCTTGTAAATGAAGTAGCTCTCGAA
AGCATTGACAAAGCTCTTTTGAAGAAGCTTAGAACTGTACTGATTGATTTCTTGCAATCA
TCATACTGCCCTTTGATTGATCAAATATTCAATGAGCTGACCAAAGGAGGAGAGTTAATT
GATGAATTTGACAAATTCCATTACTTCAAACTATCATCTTTCATGATGCAAATTTGCAGA
TTACAAGCTTATGAAAACTAAAAGAGCGAAACCCTCAAAATGTAAAAGAACTTAGAGCTT
TTGCAGGCAGAAGAAGACAAGAAAAACTTGTTTAATATCAATAAGAAGCAACAGAAGAGA
GTAGCTATGCCTAAGGTACCTTTTCATATTGACATTACTTTGATTGGTGCATCGCTTTAA
TTGTCTCATTTTGAGTTTCTCTATGCAACCTTATTTGGAGAGTTTGCAAACAAAAAGGAG
TCTGAAAGAAGAGTCAAAGATTTCCATTCTGCCCTGCAATTGATGACACAATTCCTCAAC
GTGATTAGAGATATGGCTTCTTCAGACGATGAGAAGAATAAAAAGAATGCTTAGATCTTA
CTTTCAAATGTCTTCCATCATGACATGGTAAGAATAGCACAAACAGGATTCTTGCTTTAT
AAAGAAAAGCAGCATCACAAATAATTCCTACATGACACAATTGAGTTCACTCATTTAATG
GTTAGCATGCTTGATGAGTATTCTAAGGGTAAGGTGCTCACTGTTTAAACAAACAAAGTC
AGAAAGGCCAAGAAGTCAAAAAAGAGAGCAAAGAAGCAAAAGATATTTGGAGATGTTGAC
TAAACAGATTTAGAGAGAATGAAGCACATGAATGATGAAGACATGGATGAAGACTATAAT
CCTAATAAAGTAGATGATATCAATAAGGAAATAGATGTGATAGCTGATGAGGATGATGAT
GGCTATGATAGTGGAATTATGGACAATTTATCTGATGATGAGGATGATTATGAGTAGGGT
AGTAAGTACGTTGAAAGAAACTTTAACTTCAAAGGTGAGATTTCCTTGCTAGTTGACTAT
CAGATAATCACAAGATACATGAATATTCTAAGAGACAAAGACTACATGAGAAATCCCCAA
CTGTTAGCATGCACAATCAACTGGTTCAAAAGAGTTATTAACTAACTCTAAGCTACATGG
ATATTTTTTTAGCTTGAATACTTAATGATATTCGATTAGGTTTTAAATGAAAATGCCTGC
AACAACAACTTGATGAGAAGTTTCAACTTAAATGGGCCTGTGACTGCTAAAGATAAGCAG
ATTGAAACCCTGCTTGGTGAACTTAAAACTGTCATTATAAACATTATGAGATAATTCTTT
GATACTTTCTAAAAGAACAGCTTGCTTGGAATTGAGTGCTTATACAGATTCCCATCAAAA
GAGATAAAAGATTAAGTCTTGTCAAACTACGATAACCTTGGCAGTGACATGACTGATTAT
CCAGGTAATCCAAGAAAGCAAAGTGATGACTATGAAGAAGAAGAGGAGTATAACAAGTAG
CTACCTAAAAAGTAAATGATCAATCCATATGATGATAAAAAGGATGCAGCAGTGTCAAAT
AAAGACATTTGGACTGAAGAGTAGGATTCAATTTTGATTGACAACTTTGACTAATTTAAG
CAGTTGGGAAAGAAAACTTGTTGTGACTTCCTATCTCATTTAATTGAAGGCAAATCACCT
AAGGAATGTTACAAAAGAATCAAGGTGCTTGGATTGAACAAGAAAGATGCCAATTAGGCC
AGAGAAAAATCAAAACTACTCAATCAAAAGCAGAATGTTTAATTGACAACAGCTAAAATG
GATCACGCTGTCAAGAAGTTCATCCTTACCAAGATAGGTCACAACTCATAGATTGGTCAG
TAGGATTTGTTGAAGTACTTTAACTTCATCAATGAAATTCAACTAGGTTTCAGCTAATTC
AAAGAATTTGAAGAATAAATTATTATGTTTGGTTCACCAGAGGAAATCAACGATCTCACA
AGAGCACAGGTAGATTACTCTGTAGTGGCAGTTAACAAACATCAGTTTGACATGCTTAAT
GAAAGAGCATTTGTTGAGTTGCTTTCTTCTATAAACGTTACCCAGCCTTCATAAGTTAAC
ATGATGTTCAAGATATCTACTAATGTTTCATTAGAGTTTTTCAACTAGACTATTGACGTG
TTGCTTGAAGCTCTGTCTAAATTGAGAAACAGTGAAGGTTTTTATGTTAAGGAATAAGTT
GAATCATTCTAGATTGAGATTACTAAGCATCAATAAGATAAAGATATGGAGGAAGGAGAA
GACAGGCAAAAAGAACATAAGAAAAAGCACAAGCATAAGAAGGATAGTCACAAGAAAAGT
AAAAAGCACAAAAAGCATAGAAAAGAAAGAGAGGATTCTAATGATGAGGCAGAAGATGAA
CTTAAGCAAATGGATGATTAAATGCAATCAGGCAATGATGATGAGCCACAGTGA


>Contig17851.0.g20(protein)
MEDEDVGERRIDCDEEKKLFQELLFCIQGVGSIKKINGYDVYVKHDHCEESLKDILSSVR
KDGAKYPVVKLFLGQWEFLKKDLIPLLVFHHQDKRLSFIACMIIFLITQMPDENCTDKAK
YMEHLRQYKECFIQQNVIQVLIQHLADCLQIQERNQKHEQMIELIICIFKQLLIIPEDNT
QQSNNTKNLQKRLLLVYGEENVLDSFIFMTQEFTHPFFQKMSVHFLEIWYQIFKNFTPSQ
IYKFEDGEKQALEEAEARERSKQKKHNWLRGMRHGKFGSQIQIYRDDGSSAIFGNIYSKS
IDVSQVNTHQRRKAQPRMITDQKRIIEAPQTNLVNEVALESIDKALLKKLRTVLIDFLQS
SYCPLIDQIFNELTKGGELIDEFDKFHYFKLSSFMMQICRLQAYENQKSETLKMQKNLEL
LQAEEDKKNLFNINKKQQKRVAMPKVPFHIDITLIGASLQLSHFEFLYATLFGEFANKKE
SERRVKDFHSALQLMTQFLNVIRDMASSDDEKNKKNAQILLSNVFHHDMVRIAQTGFLLY
KEKQHHKQFLHDTIEFTHLMVSMLDEYSKGKVLTVQTNKVRKAKKSKKRAKKQKIFGDVD
QTDLERMKHMNDEDMDEDYNPNKVDDINKEIDVIADEDDDGYDSGIMDNLSDDEDDYEQG
SKYVERNFNFKGEISLLVDYQIITRYMNILRDKDYMRNPQLLACTINWFKRVINQLQATW
IFFQLEYLMIFDQVLNENACNNNLMRSFNLNGPVTAKDKQIETLLGELKTVIINIMRQFF
DTFQKNSLLGIECLYRFPSKEIKDQVLSNYDNLGSDMTDYPGNPRKQSDDYEEEEEYNKQ
LPKKQMINPYDDKKDAAVSNKDIWTEEQDSILIDNFDQFKQLGKKTCCDFLSHLIEGKSP
KECYKRIKVLGLNKKDANQAREKSKLLNQKQNVQLTTAKMDHAVKKFILTKIGHNSQIGQ
QDLLKYFNFINEIQLGFSQFKEFEEQIIMFGSPEEINDLTRAQVDYSVVAVNKHQFDMLN
ERAFVELLSSINVTQPSQVNMMFKISTNVSLEFFNQTIDVLLEALSKLRNSEGFYVKEQV
ESFQIEITKHQQDKDMEEGEDRQKEHKKKHKHKKDSHKKSKKHKKHRKEREDSNDEAEDE
LKQMDDQMQSGNDDEPQ