Identifiers and Description

Gene Model Identifier

Contig5512.0.g31

Standard Name

TK1c

Aliases

Contig5512_0_g31

Description

Thymidine kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004870302.0000236365077126e-43thymidine kinase family protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5512.0.g31(coding)
ATGCAAACCAATCAATTCAAGTAAAAAGGCAGGATAGAGCTGATTTTAGGGCCTATGTTC
TCTGGCAAGTCCACTGAGCTGGTTAGAATAATTAAGAGACACAGAATAGCCAATAAAAAA
TGCTTAATAATCAATCATTAACTGGATGACAGATACAGCGCTCCAAACTATGTAGCAACT
CATGATAGAATCCAGATGGAAGCTATGTCTTGTACATCCTTGATCAAGGACGTTATAGAT
AGAAAAGTATATGAGGACTATGATGTCATTGGAATCGATGAGGGACAATTCTTTCAAGAT
GCTGTATAAGGTTGTGAAACTCTCGCATAATTGGGTAAAGTAGTAATAGTGGCTAGTTTA
GACGGTACCTTCCAAAGAAAACCATTTGGATGTTTGTTGAATCTCATCCCTCTCGCCGAG
AAAGTAAGAAAACTTTCTGCTATATGCAAGGAATGCAGTGATAATGCCAGTTTTACATTG
AGACTTACGAAAAACGATTAATCTTTATCTCTGCCCATGAATTGTGATGAATGCTCAAGA
GCAGTTAATTCATAGCAATAGCTTGCTTAAAATCTTACAAACGATGAAAAAGCTAACAAA
CAACAGCAACAAAAGTTGCCAATTTAACAGGAGGAAAAGATTGAATTGATTGGTGGTGAA
GAACTGTACAAACCAGTCTGCAGATAATGTTATTACAAGCACGGAGGATATCACTATGAA
GCTGGCATTATATAGTCAGCCCAATCTAACTTTAATGCTGTTGACAATTTGACAAACCTC
AATGGAAATGGGTTCATGACTAATAATAACAGTAATTTTGACACTAATGATACAACCAAC
GATAGTACTATTTGA


>Contig5512.0.g31(protein)
MQTNQFKQKGRIELILGPMFSGKSTELVRIIKRHRIANKKCLIINHQLDDRYSAPNYVAT
HDRIQMEAMSCTSLIKDVIDRKVYEDYDVIGIDEGQFFQDAVQGCETLAQLGKVVIVASL
DGTFQRKPFGCLLNLIPLAEKVRKLSAICKECSDNASFTLRLTKNDQSLSLPMNCDECSR
AVNSQQQLAQNLTNDEKANKQQQQKLPIQQEEKIELIGGEELYKPVCRQCYYKHGGYHYE
AGIIQSAQSNFNAVDNLTNLNGNGFMTNNNSNFDTNDTTNDSTI