Identifiers and Description

Gene Model Identifier

Contig17963.0.g107

Standard Name

TK1b

Aliases

Contig17963_0_g107

Description

Thymidine kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004870302.00017271388466e-38thymidine kinase family protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17963.0.g107(coding)
ATGTCAACAATTACAGGAAAAATGGCTAATTAGTTCAATAAGTCTATAAAAAAGCATTAA
AAAGGTAGGATTGAGCTTATTCTGGGTCCCATGTTCTCTGGTAAATCATCAGAACTTTTC
AGGAGAGTACTCAGACATTCGATTGCTTAGAGATCATGCATTTTGGCTAAATACTAGAAA
GATTAGAGACAGCTTGAGGAGACATTCAAGACAGCTCAGATCTAAACTACAAAAACGAAT
GAATACTTAAACATAATGCCAATTTCTAAGTTATCAGACTTAAATGAGTAGAACGTTAGT
GAAACTAAAGTTATAGGGATCGATGAAGGTCAATTCTATCCAGACCTCTTTGATATGTGC
TCTGAACTAGTATTAAAAGATAAAATTGTCATTATATCAGCTCTTGATGGAGATTTCGAA
CGAAAACCCTTTGGCTAAATACCTCAACTTATACCAATGTGTGATGAAATAATTAAGTTG
AATGCGATTTGTTAGAGATGTGGTGATGAAGCGCCTTTCACACATAGACTTGTGACCTCA
AAAGAAGTGGAATTAGTGGGATGGAAAGATGTTTACGAGCCATTATGCCGTCATTGCTAT
GATTCTGCTATTGGTCTAAGAAAAAAAAATGGCATATGA


>Contig17963.0.g107(protein)
MSTITGKMANQFNKSIKKHQKGRIELILGPMFSGKSSELFRRVLRHSIAQRSCILAKYQK
DQRQLEETFKTAQIQTTKTNEYLNIMPISKLSDLNEQNVSETKVIGIDEGQFYPDLFDMC
SELVLKDKIVIISALDGDFERKPFGQIPQLIPMCDEIIKLNAICQRCGDEAPFTHRLVTS
KEVELVGWKDVYEPLCRHCYDSAIGLRKKNGI