Identifiers and Description

Gene Model Identifier

Contig20698.0.g67

Standard Name

TK1a

Aliases

Contig20698_0_g67

Description

Thymidine kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004870302.0008958828286524e-54thymidine kinase family protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20698.0.g67(coding)
ATGCAAAGATCAACTGAGAACAGCCCCGGAAATTCCTCAAACAACCTCCTTTAAGCAAGA
ACTCTTTCGTCAGTCGCTCTATCTGCACACCACCCACCTAGAGGCCGCATTGAACTAATC
ATCGGTCCCATGTTCGCTGGAAAGAGCACAGAGTTGCTTAGAAGAGTGAAGAGACACGAG
ATTGCTGGAAGTAAATGCTTGAGAATCAAATTTGCAGGAGATACTCGCTACTCCGATGAC
TCAATTGCCACTCATGATAGACAAACCTAAAAAGCCATAAGCGCTAGCGTTCTTAGCACA
ATTGGCGAGATGTGGAAACAGTACGATGTGATCGGTATTGACGAGGGCCAATTCTTCCCA
GATGTGATTGAATTTGCTGAGAAAACCTCAAACGATGGAAAAGTCGTCATCATCTCTGCT
CTTGATGGTACCTTCCTAAGAACAGGCTTTGAAAATATCCTCAACCTGATCCCTAAGGCG
GAAAAAGTAAAAAAATTGGCCGCCATTTGCAAGATTTGCAATTAAAACGCTTACTTCACC
TTCCGTACAATCCTCGAGGAGACCATCCAACTTATTGGCGGAGATGAAGCCTACATCCCT
CTCTGCAGAGAGTGCTTCAATTCTGAACATACAAAATAAGAGCTGTTTAAGGATAATTAA
AACAGGAAAGCTTCTCAAAATTCACCAAACAGCGATTCCAATGAGAAGGAAGTCACTAGC
GACACCTCAAGCAGCGATGGCAGCCCAAACAAAGATTGA


>Contig20698.0.g67(protein)
MQRSTENSPGNSSNNLLQARTLSSVALSAHHPPRGRIELIIGPMFAGKSTELLRRVKRHE
IAGSKCLRIKFAGDTRYSDDSIATHDRQTQKAISASVLSTIGEMWKQYDVIGIDEGQFFP
DVIEFAEKTSNDGKVVIISALDGTFLRTGFENILNLIPKAEKVKKLAAICKICNQNAYFT
FRTILEETIQLIGGDEAYIPLCRECFNSEHTKQELFKDNQNRKASQNSPNSDSNEKEVTS
DTSSSDGSPNKD