Identifiers and Description

Gene Model Identifier

Contig82.0.g1

Standard Name

THUMPD1a

Aliases

Contig82_0_g1

Description

THUMP domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001883500.0000000000005000841553255702hypothetical protein
SGDYGL232W0.000000600201742947405TAN1 SGDID:S000003201, Chr VII
from 62075-62131,62190-6...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig82.0.g1(coding)
ATGCACTCTAAATCCCAAAACAAAAAGCGCAACCAAAAGCAACATTACAAAAAGCAGTTC
CAAAATTTTAAAAAGTCCGAGGAGCTATAAAAAGGTATCACAGGTTTCTTAGTGACTTGT
GATCAGTACAAGGAGCAGAGATGTGTCAAAGAAATTTTCAACATTTTGAATGATTAAGTC
GAGAAATTATATCCTGAGCTTGATATAGAGGGCATAATGAAGCAATGTGAAGAGAAGCGA
TGGAAAGCTAAAGAAGAGAAGAAAAGACTTCTTAATTAAGCAAAAGAACAAAATGGGTAG
AATGGTTAAGAAGAGCAAAAATAGGAGCAATAAGAATCAAATAAAGAGCATCTAGGGTTA
AGTGTCGATGAATAAATTCGTGAGGAGATCAACTAAATGAAGCGTGAACGAATGTTTTTC
ATTTTTGAGACTGGTACTGCAGGTGTAGTATTTATTAAGCTACTCGACGATTTTAGGCCC
TATATTGATGTAAATCATTTAGGAATGAGCATAATTAAAGAAGTGGCTGAGAAAAAGGAA
ACAAGCACGAGGTTCTCTTTTAGATTTATACCAGTGGATTTATTGTGCAAAGCTGGAAAA
TTTGATGAGTTCAAGCTTTTGGCTGAGCCTGTTATAAAGAAGTATTTCCCACATCTCAAA
GAAAATGAAGAATTAACAGAAGCCAATTACCGTACTTGGTGCTTAGAATTCAAAAAGAAG
AACAATGAAAGTATAGACAAAGCCTAATACTTAGACTTTCTGTTTAAATCTATTGATGGC
AAGAAGAATCCAGTTGATTTAAGACACGCAGACTATAGTGTGATTATTGAAATTTACAGG
GATGTATTGGCTTTCGCAGTTGTACCTCAATATAAAGAATTCAAGAAGTGCAATTTGCAA
TAGTTGGTCAAAGGAGAGGGTGAAGGCTAGGATGTTGACAGTGATGATGACGATTAAAAG
AAAACAGGAGGAGCTCCTGTATAAAGAAAAGTAGTTAAGATAAGTGAATTGCTTTTGAAG
AAGAGGCAGAGAGAAGAGTAAGAAAGTCGTGAATAAATTGAAGAAAATGCCAATGAAGAT
AAAGATATCAACCAGCAAACACAAGAAGAAATAAAATAAGAAATACCCAAAGAGATTAAG
TAAGAAGTCATTTAGCAATAAATCGTTCAAGAAAGTTCAAGTGAGAGTGATAATGATGAA
GATAACGAGCCTGCTTTACTTTGA


>Contig82.0.g1(protein)
MHSKSQNKKRNQKQHYKKQFQNFKKSEELQKGITGFLVTCDQYKEQRCVKEIFNILNDQV
EKLYPELDIEGIMKQCEEKRWKAKEEKKRLLNQAKEQNGQNGQEEQKQEQQESNKEHLGL
SVDEQIREEINQMKRERMFFIFETGTAGVVFIKLLDDFRPYIDVNHLGMSIIKEVAEKKE
TSTRFSFRFIPVDLLCKAGKFDEFKLLAEPVIKKYFPHLKENEELTEANYRTWCLEFKKK
NNESIDKAQYLDFLFKSIDGKKNPVDLRHADYSVIIEIYRDVLAFAVVPQYKEFKKCNLQ
QLVKGEGEGQDVDSDDDDQKKTGGAPVQRKVVKISELLLKKRQREEQESREQIEENANED
KDINQQTQEEIKQEIPKEIKQEVIQQQIVQESSSESDNDEDNEPALL