Identifiers and Description

Gene Model Identifier

Contig13311.0.g90

Standard Name

THOC7

Aliases

Contig13311_0_g90

Description

Tho complex subunit 7

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13311.0.g90(coding)
ATGGCAAGTTTGACAGATCTTTAATTTGATGAGATAATTATCAAGAGAATTTAGTTAGGT
AAAGCAGATCCAGTCTCTAAAGTCACTAATTTATTGAGTACTTTTGACAGCCTTTCTGAG
GATTAATGCAATTAGCAAGTCGAGGACATCCTAACTGAAATCGAGAACACAGAACTATTC
TTTTCAAGATCAGAAGCGTAATTTACTCAACGTCTCTACGACCACTTATATCACTAGCAA
ATCTCACAGGAAATCACTTAAGAGATAGCTACCTCAAAAAATGAAATGATAAATTTGTAA
ATTGAGCTTGAGCAACAGAGGAAGCTTAAATAATAAAAAGCTGAGTATGAGGGAATAGCT
AAGGCGATCAATGAGTATCCAAGTTAAGAAGAGAGTCTATCAAAGATAGAGGAATGTTTA
CGTGAGAAGGAATCATATGAAATTAAGGCTAAGGATGACGAAATTATCCTGAGACAAAAG
TAATTACACACTCTAGTGAGCATGATTCATGATCTAAAGAATGAGGTGCTCTTTGACTAA
ATGATGACTCAGGACAAAGCTCAGGCTGCGAAGGAAAGATAGTAGAGAAATGGAAATGAA
ATCGATTAAGAGATGTTAGACGACTATAGAGAAGCACAGTGA


>Contig13311.0.g90(protein)
MASLTDLQFDEIIIKRIQLGKADPVSKVTNLLSTFDSLSEDQCNQQVEDILTEIENTELF
FSRSEAQFTQRLYDHLYHQQISQEITQEIATSKNEMINLQIELEQQRKLKQQKAEYEGIA
KAINEYPSQEESLSKIEECLREKESYEIKAKDDEIILRQKQLHTLVSMIHDLKNEVLFDQ
MMTQDKAQAAKERQQRNGNEIDQEMLDDYREAQ