Identifiers and Description

Gene Model Identifier

Contig358.0.g96

Standard Name

THG1

Aliases

Contig358_0_g96

Description

tRNAHis guanylyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000852301.0004883026569571e-88tRNAHis guanylyltransferase fa
mily protein
SGDYGR024C7.000324531217758e-70THG1 SGDID:S000003256, Chr VII
from 532596-531883, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig358.0.g96(coding)
ATGGCAAATAGCAAATTTGAGTACGTGAAGAAGTTCGAATTTTCCAATACTCTCCTCCCA
AATACTTTCATGGTGGTGCGGATAGACGGAAGAGGCTTCACTAACTTCACAACTCAGCAT
AACTTTGAAAAACCCAATGATATCAGAGGGCTGCAGCTTATGAACAAATGTGCAAAGGAA
GTAATGAAGCAATTTACAGAGATAATTATATCATATGGAGACTCCGACGAATACTCCTTC
ATTTTCAAAAAAAGTGCAAAAGTTTTCAATAGAAGAGAAGATAAAATATTGAGCACAGTT
TTATCGTTGTTTAGCACAAGTTATGTATTTTATTGGGATAGATATTTCCAACCAGAGAAA
TATTTCAGTGAATAGGGATTAGATAGTGAGGAGATATAGAGGAAATTATAGAAAATAAGT
GAAAGAAATGATACAAGTAATTTAAAACCATAGAAATTACTGAAAGTACCTAGTTTTGAT
GCTAGAATTGTACTTTACCCCTCTCTTGAAGATATGCAAAACTACGTCTCATGGAGACAG
GTCGACTGCCACATAAACAACTAATACAACACATGTTTCTGGACCCTAGTATAAAAGGGT
GGCTTGACAACTGAACAAGCTCAGAAGCGTCTGAAAGGCACTCTGACTAAGGACAAAAAT
GAGATAATGTTCACAGAATTCGGTATAAACTACAACAATATTGATGAAATATTCAAAAGA
GGCAGCATTTGGCTTAGAATGATTAGCAAAAAGGAGTTGAAGCAGAAGGAATCACAGGAA
AATAAGAAGAAATACATGGAGAAATAGACGAAATAGAAGGGTATTCGAGAGGATTTGAGT
AAAACTGTATAGTAAGAAGAGGAGAAGAAGGAGAGTACAATAAATAATATTGATAGATAA
ATGAATTAGCTGGATATACAAGATAAAGATTCATTAGTTACTGAAGATATAGATATTAAA
AAGAAAGTCAAGGAATTGATTTTGGTTCATGACGATTTAGTGGAAAAGCCAGCATTTTAT
GAGAAGTATGAATTATATAGTAAATTAAAATGA


>Contig358.0.g96(protein)
MANSKFEYVKKFEFSNTLLPNTFMVVRIDGRGFTNFTTQHNFEKPNDIRGLQLMNKCAKE
VMKQFTEIIISYGDSDEYSFIFKKSAKVFNRREDKILSTVLSLFSTSYVFYWDRYFQPEK
YFSEQGLDSEEIQRKLQKISERNDTSNLKPQKLLKVPSFDARIVLYPSLEDMQNYVSWRQ
VDCHINNQYNTCFWTLVQKGGLTTEQAQKRLKGTLTKDKNEIMFTEFGINYNNIDEIFKR
GSIWLRMISKKELKQKESQENKKKYMEKQTKQKGIREDLSKTVQQEEEKKESTINNIDRQ
MNQLDIQDKDSLVTEDIDIKKKVKELILVHDDLVEKPAFYEKYELYSKLK