Identifiers and Description

Gene Model Identifier

Contig11490.0.g7

Standard Name

TGS1b

Aliases

Contig11490_0_g7

Description

RNA cap guanine-N2 methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL157W4.001630327199692e-20TGS1 SGDID:S000006078, Chr XVI
from 254814-255761, Geno...
T. thermophilaTTHERM_005307800.000000000007996637300921877hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11490.0.g7(coding)
ATGGTAGAATCAAATTCTTAAAACAAAAAGAAAGCAAGTGTCGGACAAACTGGCATGTAC
GGTTTTGATGAAAGAGACGACAATTTACCCCAAAAAGACTTTGAAAACTCTCAACCTCAA
AGCCAAATTTAACATCCTCCCACTAGAACTGTACATAAAGTCGGGTCGGCAAACACTATG
GAAAATATTCAAATTGAAAGCAATTAATTTGTAAAAATTCAGGAACATCGTAATATACAA
AATTTCAATGAGACATTCTAATAGAAAAAGCTCAAATGGTCCATAGAGTTCAATTCGCTG
ACTGACTTTTAGTACAAGTATGAACCTGCTTAAGAATCTGGACTTAATTCCAATTTGATT
TAAGTCAGAATATTACACTAAGAAGCTCTGTATGAAAAAGACCCTCGAGATGATTACTAC
AGTGAAATATATCATAATTACAGGAGGAAAGACGATGACTTGGAAGGTGAAGATATGAAT
GACATCTTGAAATTCATCAAGCAGAAGTATTTCATGTTCAGTCGCTATGACATGGGTATA
TGCCTGGACAAAGTGGGTTGGTTCTCTCTCACCCCAGAGCCTGTAGCTGCCTTCATGGCT
AGTTTCGTCGAAGATATAAATAAAGCCATTGTAGTTGACTGCTGCTGTGGAGTTGGAGGC
AATATTATTCAATTCGCTAGGTTGTCAAATGTCGAACAGTGCTATGCGATTGACTTAGAC
AAACAGAGAAATAAATTTGCAAGATCCAACGCAAACAAGTATGAGGTAGGAAAGAAGATC
TCATTCTAATAAGGAGACTTCCTAGAGCTAAAGGTTGAGAAGTACTTTTAAGACAAACCA
GATTCAGTCGTTTTCTTCTTTGATCCTCCTTGGGGTGGCCTAGACTACCGAGAACATGAA
AAGTTTTAAATCAAAGATTTTTTGCCCTATAATTTCCAGGAATCTCTTTGCAAGGCCTTC
AAATACAGTGTTAATATAATCTTGAAGTTACCCAGTAATATGGACTTAGATGAACTGTAC
GAGACCATAGTATAGTGCTATTGCACTACAAGAAATTAGTATATCTCTGGTGATGGCAGT
GAGTAGCTTAATATTTAAACCATGATCATCAAAACGAAATATAAGCTCAAATACTACATG
GTCTTGATTGGAAACTAACTTACTAGAAAAGACTTAACTAAGATGAGCAAGAATTTCTCA
TTACCTAAACATAGAAAAGTGGAAGAAGTTAATTAAAAATAAAAAGCTGAATCTCCTAAG
CAATCTATACCAATACCAAAGAAAGTTACCAAAGTTTAAAACGAATAACTTGGAGATGAT
GATTATGGGGTAGAGCATTTTAAGACTAGCAAAAAGAAAAAATGA


>Contig11490.0.g7(protein)
MVESNSQNKKKASVGQTGMYGFDERDDNLPQKDFENSQPQSQIQHPPTRTVHKVGSANTM
ENIQIESNQFVKIQEHRNIQNFNETFQQKKLKWSIEFNSLTDFQYKYEPAQESGLNSNLI
QVRILHQEALYEKDPRDDYYSEIYHNYRRKDDDLEGEDMNDILKFIKQKYFMFSRYDMGI
CLDKVGWFSLTPEPVAAFMASFVEDINKAIVVDCCCGVGGNIIQFARLSNVEQCYAIDLD
KQRNKFARSNANKYEVGKKISFQQGDFLELKVEKYFQDKPDSVVFFFDPPWGGLDYREHE
KFQIKDFLPYNFQESLCKAFKYSVNIILKLPSNMDLDELYETIVQCYCTTRNQYISGDGS
EQLNIQTMIIKTKYKLKYYMVLIGNQLTRKDLTKMSKNFSLPKHRKVEEVNQKQKAESPK
QSIPIPKKVTKVQNEQLGDDDYGVEHFKTSKKKK