Identifiers and Description

Gene Model Identifier

Contig19029.0.g57

Standard Name

TGS1a

Aliases

Contig19029_0_g57

Description

RNA cap guanine-N2 methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam09445 ) RNA cap guanine-N2 methyltransferase
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam01170 ) Putative RNA methylase family UPF0020
  • ( pfam03602 ) Conserved hypothetical protein 95
  • ( pfam12847 ) Methyltransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL157W9.996273942859018e-26TGS1 SGDID:S000006078, Chr XVI
from 254814-255761, Geno...
T. thermophilaTTHERM_000355409.997764199084386e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19029.0.g57(coding)
ATGGACATAGATTCAGCAAATTAAAAGAAAATTTCAGGATTTTCTAGATAGAATTTTAAT
ACTAACGCCACCCCAAATTTTTAGCAGAAAATTTAAGAAAGTTTAGAGGATCCTACCTAT
GGACATTATGAGTACGATTAAATTCCATACTAGCAACAATATAGCAATACCTATGCTCAT
TAAAACTAAAATAAATCTCATCATCAGAGATAACAAAGCGGAAATTCTCAAGGAGGCAAT
TACTAAAAGAGAAATAGTTACAGCAGCTAGAAATCGAATAATTCAAACTATAATAATTCA
GGAGGAAGAAATAGCTACAACAAGAACAGAAATGAAGAATTGCCGATTGCTGACTACTAA
ACAGATAGACTAAACATCAGCGTCCATATCAATAAATTGACTGGAAAAGAGAAAGTAGTA
ATATTGAAGCGCACAATAAAATCCTTCGCTTATCACGCTGACAACTACTATAGAGACAGT
GGATCGAAAAGAAACAATTTTACTAATTAAGAAATTGGTCTACCTCAAGATAAGGAGTTA
AAGAAGTTCTACAAGCATAGGTACTACTTATTCAGTAAGTTCGACAGGGGAATAAAAATT
GATGAGGAAAGTTGGTATTCCATAACACCGGAAACGGTAGCCAAACATGTCGCAAGCAGA
GTTACTGACGTATTTGGAGAGGGAAATGCAAACGTCATTGATGGTTTCTGCGGAGTAGGA
GGAAATGTCATTTAATTTGCTAGGAAATGTGCTTTTGCAATTGGAAATGATTTTGATGGG
AACAAATGCGAATCCTGCAAGCATAATGCCTAGATTTACAGCGTTGATAATAAATTGCAG
GTAATAAACAAGGATTTCTTGAAAATGAAGATTGAGGACATAACATATCCATAAAATACA
GCTTCAAGAATTGATGTTGTATTTATGAGTCCACCTTGGGGAGGAGTTGGCTATAATTAA
CTTGAAGAGTACAAGCTTGAGTACTTATTTCCAGACTTCACAGAAACAGTAAAAAGTGCT
TTAAATTTTTCTAGAAATTTAATCTTTTTCTTGCCTAAGAATACATCGATTAAGGAAATC
ATTGATACATTACTTCCCCACGCTAGGGAGTTTAATGATGATCCAGATAGTGATAGAAAT
GAGTTAATAATTGAAGTTGAATAAATAATGTATGGAGAATCTTGCAAGGGTATTCATATT
TACACAGGAGAATTGGTATAAATTGACCAGAAAGAGCTAGTTGATCATTTCTACAATAAT
TACTGCCATCCATTTTCTAAATCTGATGAATCATATCTAAGAGTTATTTTGGGCAACATA
TTTTAGCTTTGTGGCTATAATCACTTTGTTGAATACTTCAAAAACAAAGATGGGCCTAAA
GTGTCTCTATAAAAGATTATTAAGAAAATATAGAAGAGTTTTAGCGAAGAAGAATGGAAC
TTTTTGAAGAAATATCACAAGAGAAGTAGAACTAATTCAAAGAAGTCTTCAACTTTAAGT
CATTTTTCACACGAAGAAGAAAAAAGGTCAATGAAAAGTGAAAACTCCTCTGTCAAGAGT
CTTCCAAGAAGCACAACTTCAAGCAACAAAGAATACAAAATAAAGGATGGCAGCACAAAA
TTATCTAGAGCTGAAAAATTAGGTTAGAAATATTCTGAAAAGTATGACATAAAGTAAAAT
TCAGATGATGAGGAAATGGATATTCCAGAGAATTAATAAAAGAAGAAGGTTGTTCATTTC
CAAGACACTTCAGATCACATTCTCGAGTTGAAAGATCTTACTGAAAAAGACTTTGTAGAT
TTGTTAGCTTCCAAAAACTAGGACTAAAGGTTTTATGGTTGGTTGCACTTCGGGCCTTTC
GATGACCACAAAGAAAAACAAACTGACCCAGTTTAAGACATTGAATATTTTAAGTGGCTG
TATGACAGCAATTTATTCAACTCTAATGATGTTACCATGGAAGATGAAGAAATTAAAAAG
AGACAAAGAAACTACTCTATGGAAGAAGTTAAGAAATGA


>Contig19029.0.g57(protein)
MDIDSANQKKISGFSRQNFNTNATPNFQQKIQESLEDPTYGHYEYDQIPYQQQYSNTYAH
QNQNKSHHQRQQSGNSQGGNYQKRNSYSSQKSNNSNYNNSGGRNSYNKNRNEELPIADYQ
TDRLNISVHINKLTGKEKVVILKRTIKSFAYHADNYYRDSGSKRNNFTNQEIGLPQDKEL
KKFYKHRYYLFSKFDRGIKIDEESWYSITPETVAKHVASRVTDVFGEGNANVIDGFCGVG
GNVIQFARKCAFAIGNDFDGNKCESCKHNAQIYSVDNKLQVINKDFLKMKIEDITYPQNT
ASRIDVVFMSPPWGGVGYNQLEEYKLEYLFPDFTETVKSALNFSRNLIFFLPKNTSIKEI
IDTLLPHAREFNDDPDSDRNELIIEVEQIMYGESCKGIHIYTGELVQIDQKELVDHFYNN
YCHPFSKSDESYLRVILGNIFQLCGYNHFVEYFKNKDGPKVSLQKIIKKIQKSFSEEEWN
FLKKYHKRSRTNSKKSSTLSHFSHEEEKRSMKSENSSVKSLPRSTTSSNKEYKIKDGSTK
LSRAEKLGQKYSEKYDIKQNSDDEEMDIPENQQKKKVVHFQDTSDHILELKDLTEKDFVD
LLASKNQDQRFYGWLHFGPFDDHKEKQTDPVQDIEYFKWLYDSNLFNSNDVTMEDEEIKK
RQRNYSMEEVKK