Identifiers and Description

Gene Model Identifier

Contig1015.0.g5

Standard Name

TFIISc

Aliases

Contig1015_0_g5

Description

Transcription factor S-II (TFIIS), central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam07500 ) Transcription factor S-II (TFIIS), central domain
  • ( pfam01096 ) Transcription factor S-II (TFIIS)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL043W0.00000000000003999587784428659DST1 SGDID:S000003011, Chr VII
from 417483-418412, Geno...
T. thermophilaTTHERM_006912000.0007999190683310628transcription factor S-II

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1015.0.g5(coding)
ATGAACTATATTACAAGAAGCAGAGCAGCACCTACTGTACCAACTCTCAACAAAGACTAA
GAAATATCTACTTTAATTGGTTAGACTTCACATTTCGAGGGAACTACTTTAAACTAAGCT
ATGTTTGTTGATACCAAAGACACTATCACAAATCCTTTGCTCCTTAACTCTGTTAGTTCA
GGAAACTCTCAAGGAACTTGCTCTATAACACCAAACCCAAACAACATCTTCAGTACTTAA
TCTATTGCTAATTTGAGTGGTTCCCTATCTCTTACAGACTCAGATACTAAAAAGGTGTAA
GAAGATAGTAGACTCTCAAACCTTCTTGGAAGAGATAGTAGATAAACAAGTTCTGCATCT
CAAGATGCCCAGGAAAGTGTTGATGAAATGCTTACCCGAATTAGAGGTAAGATGAGTTAC
GAGTAGCTTATTGAGTTTATGGCTGATATCACTCTCAAGCGTCGAAGTGATCCCTAGGCA
GTCTAAACTATTCTTAAGAAACTTTATGAGAGTGAAATCGACATTAAAACTGTGGAGCAT
GCTAAATCTGAAAGACTTCTCAGAGAGTTGCTGTCTTCACCTCTTGACATGTTTATGGCT
TCAAACAAACTGGAGTTTGAAAAGATGAAGAAACTTGCCAAACTCACTCTTAAAAAGTGG
GCTGATTTGAGACGCCAACATTTGCTTGAACTCGAACAAAGCAAGTCTAGAGCCACTATC
AACAAGAAGACATTCTAGACTACTTTAGATTCAAGTGAATCCTAAGTTGAGGGAAATCCA
GGTAACTCTGACTAAATCATGAATTTGTAGCCCTCTGATAGAAGTTCAAAATCATTCTTT
GATAAAGAAAGAGACTCTGATGAAAAACATAGAAGCTCTTTGAGTTAAGAAATGGACTCA
AAAACAGATTCTAGGAAGAATGTTTCAGAAGGGGCTGATGGAAAGAAAACGGGTAAAAAG
CTTGAGTCAAAGTTGCTGAGCTTAAAAGAAGTTAAGAGTACAGCTAGAAACATTTTGGAT
CACACTAAACCTCGTGATATCAGAGCAAGTATTAATAGTATGATTGAGTATACTGGTATG
ACTTACAGAGATTAACTTAGAAGGAAACTTGTGAATATTATGAGAGATAGTATGAAGTAA
ATAGTTTATCCAGGAAACAGCAAGGCATAGCTCACTGATGGTGAGAAGAACTGGGCTACA
GAATGCGGCTTGAGAATTGAAGACTAGCTGAATGTCAGTTATAGTTAAGTCAAAACCTAC
TCTGACAAAGCTAGATCGTTGCTTTTTAATTTGAGTGACTCCAAGAACTTTGAGTTGCGA
TTTAAGATTCTCAATTAGGAACTTTCAGCTTAACAGCTCGTGCATACTGATGTCAAGAAA
CTTGCCAGTGAATGGATGAAACAAAAAAGAGAAGAGTCACTCTTGAGAACTCTATCAATG
AAGAGAACAGACTGGGATGTACAAGAAACTCTGTCTCAAGGTGAATTCCAAGGTATGTTC
CAATGTGAATGTGGAAGCTAGAAGACTGGTTACATCTAGTTGTAGATCGAAAGAGCTGAT
GAACCCATGACTAACTTTGTATACTGCTATGATTGCGAAAACAGATGGAAGTGCTGA


>Contig1015.0.g5(protein)
MNYITRSRAAPTVPTLNKDQEISTLIGQTSHFEGTTLNQAMFVDTKDTITNPLLLNSVSS
GNSQGTCSITPNPNNIFSTQSIANLSGSLSLTDSDTKKVQEDSRLSNLLGRDSRQTSSAS
QDAQESVDEMLTRIRGKMSYEQLIEFMADITLKRRSDPQAVQTILKKLYESEIDIKTVEH
AKSERLLRELLSSPLDMFMASNKLEFEKMKKLAKLTLKKWADLRRQHLLELEQSKSRATI
NKKTFQTTLDSSESQVEGNPGNSDQIMNLQPSDRSSKSFFDKERDSDEKHRSSLSQEMDS
KTDSRKNVSEGADGKKTGKKLESKLLSLKEVKSTARNILDHTKPRDIRASINSMIEYTGM
TYRDQLRRKLVNIMRDSMKQIVYPGNSKAQLTDGEKNWATECGLRIEDQLNVSYSQVKTY
SDKARSLLFNLSDSKNFELRFKILNQELSAQQLVHTDVKKLASEWMKQKREESLLRTLSM
KRTDWDVQETLSQGEFQGMFQCECGSQKTGYIQLQIERADEPMTNFVYCYDCENRWKC