Identifiers and Description

Gene Model Identifier

Contig14486.0.g34

Standard Name

TFIISb

Aliases

Contig14486_0_g34

Description

Transcription factor S-II (TFIIS), central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam07500 ) Transcription factor S-II (TFIIS), central domain
  • ( pfam01096 ) Transcription factor S-II (TFIIS)
  • ( pfam02932 ) Neurotransmitter-gated ion-channel transmembrane region

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL043W0.00000000000004998767099442072DST1 SGDID:S000003011, Chr VII
from 417483-418412, Geno...
T. thermophilaTTHERM_006912000.0005997485943342685transcription factor S-II

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14486.0.g34(coding)
ATGAACTATATTACAAGAAGCAGAGCAGCACCTACTGTACCAACTCTCAACAAAGACTAA
GAAATATCTACTTTAATTGGTTAGACTTCACATTTCGAGGGAACTACTTTAAACTAAGCT
ATGTTTGTTGATACCAAAGACACTATCACAAATCCTTTGCTCCTTAACTCTGTTAGTTCA
GGAAACTCTCAAGGAACTTGCTCTACAACACCAAACCCAAACAACATCTTCAGTACTTAA
TCTAATGCAAATTTGAGTGGTGCCCTATCTCTTACAGACTAAGATACTAAAAAGGTGCAA
GAAGATAGTAGAATCTCAAACCTTCTTGGAAGAGATAGTAGAGAAACAAGTTCTGCATCA
CAAGATACCCAGGAAAGTGTCGATGAAATGCTTACCCGAATTAGAGGAAAGATGAGTTAC
GAGTAGCTTATTGAGTTTATGGCTGATATCACTCTCAAGCGTCGAAGTGATCCCTAGGCA
GTCTAAACTATTCTTAAGAAACTTTATGAGAGTGAAATCGACATTAAAACTGTGGAGCAT
GCTAAATCTGAAAGACTTCTCAGAGAGTTGCTGTCTTCACCTCTTGACATGTTTATGGCT
TCAAACAAACTGGAGTTTGAAAAGATGAAGAAACTTGCCAAACTCACTCTTAAAAAGTGG
GCTGATTTGAGACGCCAACATTTGCTTGAACTCGAACAAAGCAAGTCTAGAGCCACTATC
AACAAGAAGACATTCTAGACTACTCTAGATTCAAATGAACCCTAACTTGAGGGATATCCA
GGCAATTCTGACAAAAACTTGAATTTAAAGCCATCTGATAGAAGTTCAAGCTCTTGCTTT
GATAAAGAAAGAGATTCTGGTGAAAAACAAAGAAGCAATTTGAGTTAAGAAATGGACTCA
AAGGTAGATTCAAGCAAGAATAGTTCAGGAGGAGTTGACGGGAAGCATAAGAGTTCAAAG
CTGGAGTCAAAGTTCATGAGTTTAATTGAAGTCAAGGGTGCTGCGAGAAACATTTTGGAT
CACACTAAACCTCGTGATATCAGAGCAAGTATCAATAGCATGATTGAGTATACTGGTATG
ACTTACAGAGATTAACTTAGAAGGAAACTTGTGAATATTATGAGAGATAGTATGAAGTAA
ATAGTTTATCCAGGAAACAGCAAGGCATAGCTCACTGATGGTGAGAAGAACTGGGCTACA
GAATGCGGCTTGAGAATTGAAGACTAGCTGAATGTCAGTTATAGTTAAGTCAAAACCTAC
TCTGACAAAGCTAGATCGTTGCTTTTTAATTTGAGTGACTCCAAGAACTTTGAGTTGCGA
TTTAAGATTCTCAATTAGGAACTTTCAGCTTAACAGCTCGTGCATACTGATGTCAAGAAA
CTTGCCAGTGAATGGATGAAACAAAAAAGAGAAGAGTCACTCTTGAGAACTCTATCAATG
AAGAGAACAGACTGGGATGTACAAGAAACTCTGTCTCAAGGTGAATTCCAAGGTATGTTC
CAATGTGAATGTGGAAGCTAGAAGACTGGTTACATCTAGTTGTAGATCGAAAGAGCTGAT
GAACCCATGACTAACTTTGTATACTGCTATGATTGCGAAAACAGATGGAAGTGCTGA


>Contig14486.0.g34(protein)
MNYITRSRAAPTVPTLNKDQEISTLIGQTSHFEGTTLNQAMFVDTKDTITNPLLLNSVSS
GNSQGTCSTTPNPNNIFSTQSNANLSGALSLTDQDTKKVQEDSRISNLLGRDSRETSSAS
QDTQESVDEMLTRIRGKMSYEQLIEFMADITLKRRSDPQAVQTILKKLYESEIDIKTVEH
AKSERLLRELLSSPLDMFMASNKLEFEKMKKLAKLTLKKWADLRRQHLLELEQSKSRATI
NKKTFQTTLDSNEPQLEGYPGNSDKNLNLKPSDRSSSSCFDKERDSGEKQRSNLSQEMDS
KVDSSKNSSGGVDGKHKSSKLESKFMSLIEVKGAARNILDHTKPRDIRASINSMIEYTGM
TYRDQLRRKLVNIMRDSMKQIVYPGNSKAQLTDGEKNWATECGLRIEDQLNVSYSQVKTY
SDKARSLLFNLSDSKNFELRFKILNQELSAQQLVHTDVKKLASEWMKQKREESLLRTLSM
KRTDWDVQETLSQGEFQGMFQCECGSQKTGYIQLQIERADEPMTNFVYCYDCENRWKC