Identifiers and Description

Gene Model Identifier

Contig9889.0.g85

Standard Name

TFIISL

Aliases

Contig9889_0_g85

Description

Transcription factor S-II (TFIIS), central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003618405.998633383648922e-18hypothetical protein
SGDYKL005C0.0000029996948234116693BYE1 SGDID:S000001488, Chr XI
from 434877-433093, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9889.0.g85(coding)
ATGGACTTCAAAGTTGGAGAGTTTGTAATTGTCTACAACATTGACAGAAACAAAAAGTTA
GTTGGAAAAATCAATGAGATCAAGGATGAAAAGATTCTGATCTTTACTATATATGCTATG
CCAGAAGATTTACCCATGGGTAGATAGCAGTATCATTCCGCTTTTGAGTTGATAAGGACA
GATGAGACAGCCAAGGAATTTGTTGAAAACGCAATCAAAAAAGTTGAGGTTTTGAGATTA
CAAGATTTCAAGTAGAGATTTAAACATCCTGCTAAGGAGCTTTCACACATCAAAACTCCA
CTGAGCAATCAAACTGTAGATGATGCAGATGTGTTCTTTTTCAGATAGAGATTCACTAGA
GTTAATAGCAGTACTGCTTCATCTATTCCAGGAAAACAAACTCAGTAAGGTACATATGCT
CCAGAACTCAAGTAATCCTGCTTGTGCCGCAAGATTCTGAATCCAGATGACGAGACTATA
ATGTGTGAAAATTGCTCATCTCTCTTGCATCCTCAATGTCTGAGATAAAATGCTGACAGA
AAGTGCTATGAGTGTGGAAAGGAAGTTCCCATCAAAGCCATTTACAGTCTTAAGAGGTAA
GCCTTGATGAAAGATGATGAAGAAGAGGAACAGAAAGATCAAGGTGAGACCTTATCAGCT
GTTGAAGGTGACTAGTTCAGAGACATCAAACGTCAAAGACTAGACGCAGCCTCCACAATT
CCACAGCAAATTGAAACTGAAGCCACCACTGTCACTGCTAAATCAGCATTCCCCTCTCTC
AAGAACTAAGAGACAGCCAAGAAGCTGGATGAGCATGTGAATTAGATTAGATAGAACAGT
GAAAACTACAATTTGATCAACAGTGTCAGTGGAGTCCAAAAGACCAGGAAAAATGTCAGA
GAGAACTTTGCTATTGCTTTGATGCTTGGGTTAGAGGAGAGTAAGGAGCGAGGAGACTTT
AACAAGATTCAAGGCGCTTCAGAGAGCGATAAAGAAGATGAGAAGTATCTGGTTTGCATG
AATCTAGCTTTGAATATTGAAAGTCACATGTGGGTTCTGTACGATGAATCTATCAGCAAA
GAGTACAGTTCCAAGTACAGACAACTGCACACTGCTCTGCGTAATGATGAGAACTATGAG
TTGCGCTTAAAAATACTAATGGGTGAGATTGAACCATCCCAAGTTCCCGATCTGTCAGTG
AATGACCTTGCAAGCAAGATTCAACAAGAGAAGAAAGAAATGTAGCAAAAGAAGTTCTTT
GAGGAGCAGGTTGTTGTCAATGAGCCACTTCAAATCATTGTCAGATCTCATAAGGGCAGT
GAGATACTTTAGTTAAACGTTGATGAAAGAAAAGTAATTAGCTAAGAGGAAGTAAGTGGA
TCCTTACAATAAAATCTACAATCAATGGGTAGTATCTAGTAAGCAGCACCATCTTCTAAC
TTAGTCTAGGATAGCGTTAAAACTGCATAAGATTAGGCTGAATCTGCTGATTCTGTGGGC
TAAGCTTAGATTAACCGCTAAAAGGATTCATCCACTTAAAACTAAACTGAGGATTTAAAG
CAATCAGAAGATGCTTAAACTCTTGAACCTAGAGTAGTTTCTTAAGTTTACCCAGCCTCA
TTCTTAGCAGAGCACAGAGAGTTGCTTGATGATTTGAACTCAAGATGGTCTATGAAATCC
CTCACTTAGAAGTTCCTGGACAGACTTAATGGTCATCTGAAGGCAAATATTCTAACTAGA
GATGATCTTGTCAAGAAAGTTTAGGACATGAGTGGACTCTATGAGAAACATCAGCAGAAA
ATCATTCTCAAAATTAAAGGAAGTAGCATTGAAAAGTAACAATAAGAAAATCATTGA


>Contig9889.0.g85(protein)
MDFKVGEFVIVYNIDRNKKLVGKINEIKDEKILIFTIYAMPEDLPMGRQQYHSAFELIRT
DETAKEFVENAIKKVEVLRLQDFKQRFKHPAKELSHIKTPLSNQTVDDADVFFFRQRFTR
VNSSTASSIPGKQTQQGTYAPELKQSCLCRKILNPDDETIMCENCSSLLHPQCLRQNADR
KCYECGKEVPIKAIYSLKRQALMKDDEEEEQKDQGETLSAVEGDQFRDIKRQRLDAASTI
PQQIETEATTVTAKSAFPSLKNQETAKKLDEHVNQIRQNSENYNLINSVSGVQKTRKNVR
ENFAIALMLGLEESKERGDFNKIQGASESDKEDEKYLVCMNLALNIESHMWVLYDESISK
EYSSKYRQLHTALRNDENYELRLKILMGEIEPSQVPDLSVNDLASKIQQEKKEMQQKKFF
EEQVVVNEPLQIIVRSHKGSEILQLNVDERKVISQEEVSGSLQQNLQSMGSIQQAAPSSN
LVQDSVKTAQDQAESADSVGQAQINRQKDSSTQNQTEDLKQSEDAQTLEPRVVSQVYPAS
FLAEHRELLDDLNSRWSMKSLTQKFLDRLNGHLKANILTRDDLVKKVQDMSGLYEKHQQK
IILKIKGSSIEKQQQENH