Identifiers and Description

Gene Model Identifier

Contig517.1.g109

Standard Name

TFIIFBetaLd

Aliases

Contig517_1_g109

Description

Transcription initiation factor IIF, beta subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( pfam02270 ) Transcription initiation factor IIF, beta subunit

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig517.1.g109(coding)
ATGAATTACTATAACCAAACTTAAAATCAGCACAGCAATTTCATAAATTTAGAGACGCCG
TCTCAGCCCAAGAAACCTCTGTTGCTTGGTGTCAATGAAATTCAGAACTCAAACATGAAC
CCCCGATAAAATTCAAACTATCCTCAGAAATAAAACAGCAGCAGCTATCAACTACCACCA
GATTAATAAAATTTGAGCACTGATTACCAGAATAATTAGAATTTGTAGGTAGCAAGCCAA
TTCAACTCACATGATTATGCTTGTAACTATGGTGAATACCAGCAGATCGGCTAAGGAAAC
TCTGTGAGTGGATAGTAGATGATACCTCAAAATTAGCTTCTTTAAGCGGGACAGATATAT
CTAGTCAAGTTGCCAAAGAGAGTTCACGATGTTATGACTTAACTTCAAAGTCAACAAGCA
AACAGTGGAAGAAACAGTCAAGAGTTGTTAGACCTAGGTGAGATCTGCTTAAAGTACGAC
TTATCTAATGGTAAAGAAGCAGATCAATCCGCATAACAAGCACCAGTTATGAGGTTTAAA
GAACCTTCAGGTAAAGTTTGGAAACTTAAGTTGAACATTCTTGATGAAGACAAAGGCTCC
TCTAAATCTAAGAGCGATAGAGAAATTCAACCTGATAACTTTCATAATCTTGTTGAAAAT
TCAAAAACTCAAGGACTTGGTTTAGGCATGGATGTGGACATGAATGAAGACGAGGACTTG
TTTGGAGATAAAGGTTCGACTGTGAACGAGAGCTTTGAGAGTTTGAAGTAAAATGCTGAA
AAGCAGAAGATTGCATAGATTATGAATCAGCCTACTAATGCTATTATCTGTGAGGATTTG
AGAAAGAGAGGAAGCTAGATGTTACCAGTGAGTTGCAGAGTGAACACAGTGCCTTAGATG
TACTAAGTGAGGGAAGAGGTCAAGAGTGGACTATTCCGTAGCGATGAAGTCCTTACCAAG
AAAATCAACGTCACCAATATAAGTCAATACTAAGTCCCCTTTGAATTCAAAATAAACAGA
GAAGATGAGCTTAGGCAATCCCCAGACAAAGATAGATCTGCTAATGGTATGAGTGACTCA
GATTATGATCAGAGATCCAGAACTCTTCAGAAGACTAGAGGAAGACCCCCAGCTCCTACT
TCCTTCGGCTAGAAGCAAAAACGTGTGACTATGCCTTAACCCCAACTTCAAGAAAACTTG
TTCAGACTATTCAAGGATACCCAGGAGTTCAAAATCCATGAATTGGAAGTCATTCTCAAT
CATCCAAGAGGCACTTTGAAGGAAACTTTGACATAGATGTGCCGCTACGACAACAAGAGA
AAGGTATACTCACTCAGAGAAGATTTTCAGCCTTGA


>Contig517.1.g109(protein)
MNYYNQTQNQHSNFINLETPSQPKKPLLLGVNEIQNSNMNPRQNSNYPQKQNSSSYQLPP
DQQNLSTDYQNNQNLQVASQFNSHDYACNYGEYQQIGQGNSVSGQQMIPQNQLLQAGQIY
LVKLPKRVHDVMTQLQSQQANSGRNSQELLDLGEICLKYDLSNGKEADQSAQQAPVMRFK
EPSGKVWKLKLNILDEDKGSSKSKSDREIQPDNFHNLVENSKTQGLGLGMDVDMNEDEDL
FGDKGSTVNESFESLKQNAEKQKIAQIMNQPTNAIICEDLRKRGSQMLPVSCRVNTVPQM
YQVREEVKSGLFRSDEVLTKKINVTNISQYQVPFEFKINREDELRQSPDKDRSANGMSDS
DYDQRSRTLQKTRGRPPAPTSFGQKQKRVTMPQPQLQENLFRLFKDTQEFKIHELEVILN
HPRGTLKETLTQMCRYDNKRKVYSLREDFQP