Identifiers and Description

Gene Model Identifier

Contig7219.0.g20

Standard Name

TFB4

Aliases

Contig7219_0_g20

Description

Transcription factor Tfb4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7219.0.g20(coding)
ATGCTCTTTATCAACAGCTATGATGAAGGCAGTATTTTCAACAAAAAGTGGATTGAAGAC
GTTGCAGTGAAAAGAAGTGAATCATTCTCAGCCAGAATCATGATAGTCAAGTTTCAATCT
GAAGACCCAACTCAGTATAGCTCTCTCGTTAATGCTATTTTTGCTGCTTAAAAATTGAAG
ATATCGGTTGATAGTCTGATTATATAGTATGCTCCACCATAAGCAATTTAAGAACCCTAG
GATGGTAAGCAGCAACCTGCCTCCTAAGATGAGGAATCAAGTCTTCTTTAACAAGCAGCA
CTCTTAACTAATGGGACCTCTTACAAACTATTTTCTAACAATTTAGGTCTGAACTATTCC
CCACTTTGCTTGAACTGTTTTCATGCAGTAAGACTACACAAGAAAAACTCAAAATACCCA
GTATTGACATGCTTGAATAGCAAAATATGA


>Contig7219.0.g20(protein)
MLFINSYDEGSIFNKKWIEDVAVKRSESFSARIMIVKFQSEDPTQYSSLVNAIFAAQKLK
ISVDSLIIQYAPPQAIQEPQDGKQQPASQDEESSLLQQAALLTNGTSYKLFSNNLGLNYS
PLCLNCFHAVRLHKKNSKYPVLTCLNSKI