Identifiers and Description

Gene Model Identifier

Contig1013.1.g89

Standard Name

TERT

Aliases

Contig1013_1_g89

Description

Telomerase ribonucleoprotein complex - RNA binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam12009 ) Telomerase ribonucleoprotein complex - RNA binding domain
  • ( pfam00078 ) Reverse transcriptase (RNA-dependent DNA polymerase)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001125602.0006398763136557e-76Protein kinase domain containi
ng protein
SGDYLR318W0.00000000000040012475857291343EST2 SGDID:S000004310, Chr XII
from 766542-769196, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1013.1.g89(coding)
ATGAGCGCGAAGAAGCCAGTTCAATCAAAACTAAACATTGGTAACCCTACAATTCCAGTT
ACTAATACCAGATCTACAACACCTAAGCCAGTACCAGGTCAACCCTAATTTGTGAACTAA
GGGTAGAAATAATAAAGTTAAAACACAACGACAGGACCTTTTAGAAGCAATTAAAATAAC
ACTAATAGTGGAGGAAATGGAAACTTTGAACTTGATGATTTGCATTTAGCTTTAAAATCT
TGCAATGAAATAGGCTCTGCAAAGACTTTGTTCTGTTTCTTTATGGAACTTCAAAAGATT
AACGATAAAATACCATCAAAGAAGAATACCGAGCTTATTAAGAACGATCCACACTTTTAA
TACTTTTGTCATAACACAATTCTATGTACAGAGTAATCTTATGACGAGAAAACCATTGAA
AAGTTAGCAAAGTTGGAATATAAGCTTGATTATAAGAATTCTTATATTGATATGATATCA
AAAGTTATCAAGGAATTGTTGATTGAGAATAAGCTTAACAAGCTATAGACTTTCGGTTAT
AAACTTGTTAACAATGAATTTGGAAACTAAAATCACTTGGGTATGATGTAGCAAAATTAA
GATTCTTCTCACAACTCAAATTTCATGGTAAAATGTGACTATATTAACCTCAATAAGTAA
TGCATGATTACTAAGAACTGGGAGAAAGTGTACTTCTACCTCGGTGACCATTTATTTATG
CACATCTATAAGGAGTATATGATCTTTTTGAAAACAAGAGATGAATCTTTGGTACAGATT
AGTGGAACAAATATCTTCTGCTACTTGAATGAGAAATTAGGGAGACTACAAGCTGCTTTC
TATGAAGGCCCAAATAAAAATGCGGCAAATGCAGCCGCACAAGGATAAAATCCCGAGGCT
AATGATTTGATTAGTGCTGAGCAAAGAAAAATTAATAGAGCAATAGTCATGAAGAAAACT
CATAAGTATAACATTAAAGCTGCAGACGAATCTTATTTGACTAACTAAGAGAAGGGTTTC
TGGGATGATCAAATCAAAAGAAATCGCTTGTTCTATTGTGCTCATTAAAATAGAAACAAT
AGGTTCTTCTAAAAGCATATCTTGAATAGCAAAAATCTAAGTTAACAGCAAATTAGAGAT
AACATATATAAGGAGGTTTTTGGATTTAATAGAGTGAGAGCTGAACTTAAAGGAAAAGTT
ATGAATATAATTGAGCAAGTAATAGTTAATCAGAAGAAGTTCGACTTCAAGTATTACCTG
TCCAAGAACTGTCCACTACCAGATAATTGGAAAAATCTCAAGAAATCATTTTTGGAAGAT
GCAGCTGTATCAGCTGAATTGAGAGGTCAAGTATTTAGATAGCTCTTTGAATACCAATAG
GATCAGAGATAAATCTCAAACTTTTTGACAGAGTTTGTGGCTAATGTTTTCCCTAAGGAT
TTCCTAGAGGGCAAAAATAAGAAAATCTTTAACAAGAAAATGCTACAATTTGTAAAGTTC
AATAGATTTGAATCATTCACTAAAATATCTCTACTTAACAAATTCAGAGTGAATGAAGTT
AGTTGGTTGAATTTTAAATGCAAAGATGAGAATAAGAAATATTTTATGAATGAAAATGAG
CATGTATTTTTCAAAGTCTTAAAATGGGTATTTGAAGATCTCGCAATAACACTTATGAGA
TGCTACTTTTATAGCACTGAAAAGGCAAAAGAATATTAAAGAATCTTTTACTACAGGAAA
AATATTTGGAATATGATTATGCGTCTTTCTATTGATGACCTTTTAAAGTAAAATCTTAAG
ATGGTAGAGAAAAAGGAAATGAGAGTTTTCTGTGAGTCATAAAACTTCGCTCCTGGTAAA
CTTAGACTTATTCCTAAAGGAGATACTTTCAGACCAATTATGACTTTCAATAGAAAGATT
CCAAACTAAGTTGGTAAATTCCAAAGTAGAATGACAACAAACAATAAACTTCAAACTGCT
CATATGATGCTTAAAAATCTTAAGAGTAAAATGTTTAAGCATAGTTTTGGATTTGCTGTC
TTCAACTATGACGATATTATGAAGAGATATGAGAATTTTGTCTAGAAATGGAAGCAGATA
AACTCACCTAAACTTTACTTTGTTGCCATGGATATAGAGAAGTGCTATGACAATGTGGAT
TGCGAGAGAGTTGTTAACTTTTTGTAGAAATCTGATCTTATGGATAAAGAATACTTCATT
TTAAATACCTTCGTTTTAAAGAGAAAGAACAATATCATTGTAGAGCGATCTAACTTTAGG
AAGCTGCCAATTAAACAGTATTTCAGGTACAAGTTTTAGAAGATAGGTATTGACGGCAGT
TCATATCCAACACTTTTTGAGATCTTAGAAGATGAGTTCAATGATCTTAATATGAAGAGA
ACAATTATAGTCGAATAGGAATAGAGAAAGAAATTTCCTAAGAATGATTTACTACAACCT
GTATTGAAAATATGTCAGAATAATTACGTGACCTTCAACAAAAAACAATACAAATAAATG
AAGGGTATACCCCAAGGTCTCTGTGTATCCTACATTTTATCATCCTTTTATTATGCCAAC
TTAGAAGAAAATGCCCTGTAATTCTTAAGAAAGGAAAGCATGGACCCAGAAAAACCAGAA
ATTAACTTGCTCATGAGACTCACTGATGATTACTTGCTTATGACTACTGAGAAGAATAAT
GCCATGCTCTTTATCGAAAAATTGTATTAGCTCTCTCTAGGAAACTTCTTTAAATTTAAC
ATGAAGAAGCTTAAAACTAATTTTGCCTTGAACCTCCAGAAAATTGGTTGCACAAACACA
ACATAAGACATCGACTCTATTAATGACGACCTATTTCATTGGATTGGAATCTCAATAGAT
ATTAAGACCTTGAATATCATCTAGAACATTAACACTAAAAAGGAAGGTATCTTGTGTACT
TTGAATGTAAACATGCAGACAAATGAGTCCATTTTATGGCTGAAAAAGAAGCTCAAATCT
TTCCTAATGAACAATATCTCCTTTTACTTTAAGTCCACCATTAACACAAAGCAATTCGCT
AACATTACTTTGAGTAAGCTTTACATTGCAGCAGCTGAGAAATACGTCGCATGCTGTCAA
GAATTCAAGCGTTTCCATGAAAACACCTCCCTAGGTTGTCAAAACATCGACATAAAAATC
ATCCACATCATTTATGTGGTAATTAGATCGTTCTTCAAGTACTTGGTTTGTAACGTCAAG
AGCCCAGTATTTGAAAGAGACGATTATTAACAGTTCTTTATTTACAGTCTCAAATTCTTC
ACAACAAGATTTAAGCAGCAGAAGAACGAATTCGCTGGCGTTTACAAAATTCTAATGGCG
AAGGAGAAGAAGCTGGAAGTTGCAAAGATAGAGTTCTAGATATAATGA


>Contig1013.1.g89(protein)
MSAKKPVQSKLNIGNPTIPVTNTRSTTPKPVPGQPQFVNQGQKQQSQNTTTGPFRSNQNN
TNSGGNGNFELDDLHLALKSCNEIGSAKTLFCFFMELQKINDKIPSKKNTELIKNDPHFQ
YFCHNTILCTEQSYDEKTIEKLAKLEYKLDYKNSYIDMISKVIKELLIENKLNKLQTFGY
KLVNNEFGNQNHLGMMQQNQDSSHNSNFMVKCDYINLNKQCMITKNWEKVYFYLGDHLFM
HIYKEYMIFLKTRDESLVQISGTNIFCYLNEKLGRLQAAFYEGPNKNAANAAAQGQNPEA
NDLISAEQRKINRAIVMKKTHKYNIKAADESYLTNQEKGFWDDQIKRNRLFYCAHQNRNN
RFFQKHILNSKNLSQQQIRDNIYKEVFGFNRVRAELKGKVMNIIEQVIVNQKKFDFKYYL
SKNCPLPDNWKNLKKSFLEDAAVSAELRGQVFRQLFEYQQDQRQISNFLTEFVANVFPKD
FLEGKNKKIFNKKMLQFVKFNRFESFTKISLLNKFRVNEVSWLNFKCKDENKKYFMNENE
HVFFKVLKWVFEDLAITLMRCYFYSTEKAKEYQRIFYYRKNIWNMIMRLSIDDLLKQNLK
MVEKKEMRVFCESQNFAPGKLRLIPKGDTFRPIMTFNRKIPNQVGKFQSRMTTNNKLQTA
HMMLKNLKSKMFKHSFGFAVFNYDDIMKRYENFVQKWKQINSPKLYFVAMDIEKCYDNVD
CERVVNFLQKSDLMDKEYFILNTFVLKRKNNIIVERSNFRKLPIKQYFRYKFQKIGIDGS
SYPTLFEILEDEFNDLNMKRTIIVEQEQRKKFPKNDLLQPVLKICQNNYVTFNKKQYKQM
KGIPQGLCVSYILSSFYYANLEENALQFLRKESMDPEKPEINLLMRLTDDYLLMTTEKNN
AMLFIEKLYQLSLGNFFKFNMKKLKTNFALNLQKIGCTNTTQDIDSINDDLFHWIGISID
IKTLNIIQNINTKKEGILCTLNVNMQTNESILWLKKKLKSFLMNNISFYFKSTINTKQFA
NITLSKLYIAAAEKYVACCQEFKRFHENTSLGCQNIDIKIIHIIYVVIRSFFKYLVCNVK
SPVFERDDYQQFFIYSLKFFTTRFKQQKNEFAGVYKILMAKEKKLEVAKIEFQIQ