Identifiers and Description

Gene Model Identifier

Contig17549.0.g47

Standard Name

TDRD3b

Aliases

Contig17549_0_g47

Description

Domain of unknown function (DUF1767)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08585 ) Domain of unknown function (DUF1767)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17549.0.g47(coding)
ATGGAAATTGACGAAGACAATAGTAGCAACCTAGAGCTAGAGTAATAAGTTTAAGAGCAT
CTCCAGCAGTTCCTGCTCTTCCCACCCTTAAAATACCTAACTCAATATTTGAAATCGTTG
AACATATCCTCCTCCTAATCTATAAACCCTAAAAAGCTTAACAAGCTCCAAGACATGATC
CTACGTTAAGACCTTTGTCAACTCTAAGATTACGACTAAATTCCACCGAGGCATCGCTTG
GTGCCCGCATAATTCGAACAAAAGCATACAATAGTAGATTTGACTGATGAGTCGAGGGGC
ACCTACGGTATCTTAGTGCAAGTGCAAAAGATCATAAACATTGGAATGCCTCAAAAGAAC
CAGGATGACGATAACAATCACAGTGATGAGGAAAATGAAAACGACAATGAATTTACTTAA
AACACATAGATTTCTTAATATCGCATTGAGAAATTCGAAAACAAGTATCTAGAATCAGCC
TAGTTAGACGCCAAAAAGCGCAACAATAAAGAATAGAACCGCATGTTTAAGTTGCTCTTG
ACTGATGGTAAGACAGACATCATCGCTATTGAACTTGAGAAAATTTACAGTTTAAACCTG
GATAACACATAAATTGGTAGCAAATTGAGACTATAAGGCGTCATAGAAGTACGAAGAGGC
ATTTATATGTTGAGAAATGACAACGTAGAAGTATTATGGAACAACAAGGAAAATCCACAG
TTTAAAACAACTGGCAGCACTGGCTTCAATCAAATCACTGAGAGTCTCTTAAACCCGAAA
AGCTTTGAGAGAAAAGGTTTGTTACAAAAGAGAAAAAGAGGTGAAGACGATGGCGGAGGA
GATAAAATTGGATTAGAAAGTGAGAAAATATTCAAGTAGAAGATTGAAGAAATGGTTAAT
AATCAAAAGAATTTTAAGTATCAAGATCAAATATATAATGAGTAAGATTTTATGTGA


>Contig17549.0.g47(protein)
MEIDEDNSSNLELEQQVQEHLQQFLLFPPLKYLTQYLKSLNISSSQSINPKKLNKLQDMI
LRQDLCQLQDYDQIPPRHRLVPAQFEQKHTIVDLTDESRGTYGILVQVQKIINIGMPQKN
QDDDNNHSDEENENDNEFTQNTQISQYRIEKFENKYLESAQLDAKKRNNKEQNRMFKLLL
TDGKTDIIAIELEKIYSLNLDNTQIGSKLRLQGVIEVRRGIYMLRNDNVEVLWNNKENPQ
FKTTGSTGFNQITESLLNPKSFERKGLLQKRKRGEDDGGGDKIGLESEKIFKQKIEEMVN
NQKNFKYQDQIYNEQDFM