Identifiers and Description

Gene Model Identifier

Contig21255.0.g14

Standard Name

TDRD3a

Aliases

Contig21255_0_g14

Description

Protein of unknown function (DUF3069)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam11269 ) Protein of unknown function (DUF3069)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21255.0.g14(coding)
ATGTTAAACTAAGCTTAAGCTTTAAACTTTCTGACTTTACAATCTCTCTATCCAGTGAGT
TCCTGGTTGACATAGAATCTGCCTTTACATAAATCTCTTCCATCACTTCTAAACTAATTT
TGCAAACAGGACTTTACTAAGGTAGTGGACACTACAAAATTGAAGCCATGGAAGTTTAGT
GAAGATGTGAAGATTGGGGTTACTGAGTGCAATATGGCAGTGCAGATTGTATCAGCTGTT
AATGTGGGGTTGAGCAAGAGAGAGCAGGACGATGTGGACTAGCAAGATAGTGACAATGAA
GACGATGAGAACAACAATGCTTCATAGAAACTTGACAAACTTGAAAGTGCTTACCTAGAT
CCTAAAGTTATGAAAGAGAAGAAAAAGATCAGAAGAGACAACAAGAGACTCATGAAACTC
ACACTCACAGATGGCTTCAACACACTCTATGCAATTGAAGATGAAAGACTCATAAGCATG
CATTCTTTTGAGGAAGGCCAGGCATTGCTGCTTTAAAAAGGTGTAGAAGTGAGAAGAAAT
ATCATAATGCTTTCTCCTAAAACTGTTAGTTATCTTGGTGATGTACCCAAAGAAGCCACT
TAAACTATTGTCATATAGAAAAACTAAACTTATCAAGGTAACAATGAAGAGACTAAGGGA
GGTGGCGGTACATAAAATTAATATCCAAGAAATAATTATGGTTATCAAAAAGATTCCAAT
AGTAACGCCACCAACTAGGCTTCTAATAATCAATAATAATTTTAACAAAACAATGCAGCT
TAACCATATAATCAGAGTAACTACAATACTAGGGCAGCTGCTTATTAGAACTAAAATCAG
TAGAATTTTCAACCAAATTCCTCTTCACAATATAAAGGAAATAACTATTAAGCCTAAAAT
AACTACAAGTCTTAAGGGTACAACTAGAGGAAGACCACAGATGCTCAAACAAGCTATAAC
AACGGAGACTTCAACAATCAAATAAAGCCAAAACCTGGATAAGACTAGTTGAATCAGAGA
AAATACGATTAGGTTTCTAATGATGATCTAGATATTGACCCTGACGATTTACTTAATGCG
CTAAGTGAAGAATAAGATTTTGATGAAAATGATTTACTAGACATATTAAACGACGATGAT
GGTGTAGAAGATGGAGCCATGAAGGGAGGGTATAAGATGCAATAGTAAAATTAATAAAAT
ATAAAGAGCAGCTAGATGATTTAACAGTAAAGATATGGACAATAAAACAATGACAGTACA
GAAAGTGCTTTTGACTATGATAACTTTAAACCAGCTTAACCTCAAATATAGTAATAGCAA
ATTAAGCAACTGTATAATGCCTCTAGTTATAACAACAACAATAACTCAGTCAAATAATTC
AACAAAAATAATAACTATTAAAGTCATTAATAGTATTACCTATAGAATAACAACTCTGGT
AATTAAGCAATTAATCCGGCTAAACCCAGAAATGTTAATGAACTTTGTTTAGATAATGAT
GACGAAGATAGTGAGATATGTTTTGTTGACATGGATTGA


>Contig21255.0.g14(protein)
MLNQAQALNFLTLQSLYPVSSWLTQNLPLHKSLPSLLNQFCKQDFTKVVDTTKLKPWKFS
EDVKIGVTECNMAVQIVSAVNVGLSKREQDDVDQQDSDNEDDENNNASQKLDKLESAYLD
PKVMKEKKKIRRDNKRLMKLTLTDGFNTLYAIEDERLISMHSFEEGQALLLQKGVEVRRN
IIMLSPKTVSYLGDVPKEATQTIVIQKNQTYQGNNEETKGGGGTQNQYPRNNYGYQKDSN
SNATNQASNNQQQFQQNNAAQPYNQSNYNTRAAAYQNQNQQNFQPNSSSQYKGNNYQAQN
NYKSQGYNQRKTTDAQTSYNNGDFNNQIKPKPGQDQLNQRKYDQVSNDDLDIDPDDLLNA
LSEEQDFDENDLLDILNDDDGVEDGAMKGGYKMQQQNQQNIKSSQMIQQQRYGQQNNDST
ESAFDYDNFKPAQPQIQQQQIKQLYNASSYNNNNNSVKQFNKNNNYQSHQQYYLQNNNSG
NQAINPAKPRNVNELCLDNDDEDSEICFVDMD