Identifiers and Description

Gene Model Identifier

Contig20252.0.g83

Standard Name

TDRD

Aliases

Contig20252_0_g83

Description

Staphylococcal nuclease homologue

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006001109.99860868304602e-64Tudor domain containing protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20252.0.g83(coding)
ATGGTAGAAAAGAAAGAAAAAGTAGACAAAGTCATCAAGGGACTTGTCAAAGCTGTATTT
TCAGGTGATTATATCACAATAACTAAATCATCTAAGCAACATGGACCATCAGATCACAAT
GTTTATCTTGCTTCAGTTCAAGCTCCAAAAATAGGTAGCTCAACCAGAGTAGAAGAGCCA
TTCGCTTTCGAAGCAAGAGAATTTTTAAGAGAGAAAATTATTGGTAAAAAGGCAGAATTC
ACTAACGAATACAACTATGGAGGCAGAGATTATGGCACTTTAGTAGTAGATGGATTGAAT
TGCAATTTGGCTATTGTAAAAGCTGGTTTAGCTAGAGTTATTGAGAAGAAAGGAGCTATG
GCTGCAAGCTCACATTATGAAGAATTGGTTAATGCTCAGTCAGATGCGAAGAGCAAGGGA
ACAGGTCTCTGGAGTTCTTAAGATGACAAATTCCTCGACAAACACACAAGAAAAGTGACA
TACTTCACAGATGCAGGTTATAATGCCCCAAGACTGCTAGAAGATGCTAAGAAAATTGAT
AAGCCACTTGAATGTATCGTAGAGTACGTGTTCAACTGCAGCTACTTTTCCGTTTTCATC
CATAAATTCCAAACTGTAATAAAGCTCTCCTTAGTACATTTATTCACACCTCAGACAGAT
AAGCAACTTGTGGACGATGGCAAGAGATTCGTTGAGAAGCTTATATTGCACAGAACAGTC
GGAGTTAAGCTGGAGAGAAGTGAAGAGGGTGGCACTTTAGTTGGAAGAATTTATCATCCA
GCTGGTGATATTGCTTATGAATCTTTGAAGGGTGGGTATACCAAATTGAACATGCCAAAG
AATATCGATTTCGATGCTGACTACTTCAAGACTCTCAAAGAGGCTCAACTTATCGCTCAA
TCTAAACAAGCTAGAATCTGGAAAGATTTCAAGCCAGAGGAGTAAAAATAAAAGCAAAAG
GCCTCTGCTACTGATTTTACAGGAAAGGTAGTTGAGATTCACACTGGTGACTCATTGACC
ATTGAAAGAGAATCTGATTTAAAGCAAATTAGAGTTTTCTTGGCAACTGTCAAGGCACCA
TTGTTGAATAAGAAACCTGGCGAAGACCCAGATGCATATGCTTGGGACAGTAAGGAAGCC
ATGAGAAAAGCTACTATTGGTAAGAAAGTCAAGGTTATTATGGAGTTCAGCAAGACAGTG
AATGAAAGAAACATGGACTTCGCCACCGTGATTCTGGACAAAACAGGCAAAAACGTGTCC
TGCATTCTGCTGGAGAAGGGGCTGCTCAAGACCAACGTCACTAAGAGTGGGGACAATGCA
AGCAAGTTCATCGAGGATCTGCTCGCCAGTGAGAAGAAAGCGGTAGATGCAAGGCAAGGC
ATTTTCTCAAATCAACCAGCACCAATCAGAGTATTCAGCGATGTTGTAGCCAATCCAAAG
AAAGCAAAAGACTTTGAAGCCATGGTTATGAAAAGACCAAACAGAAAAATGAATGGTGTT
ATTGAATACTGTTTCTCTGGCATGAGATTCAAAGTTAGATTAGATGGTGAAAACACTGCA
ATAGGTCTCAATCTCCTCGGTGTTAGAACTATGATTAATGATAAAAATCAACCTTAACTT
ATGGAACTTTCTAATGAGGCCCTTGCTTTCGCTAAAGAGCATCTTTTCCAAAGAGATGTT
GTTGTTGAACCAGACTTTGCTGATAAGAGAGGTTCATTCTTTGGAACAGTCACTCTCACC
AACAAAAAGGACTTTGCTTTGATGTTAGTTTAAGAGGGTCTAGCTGAAGTCAGTATTATT
GGAAACAAAGCTCCATTAAATATCGAAGAACTAGAAAATGCCTAAGAATAAGCAAAAGCT
GATAAGCTTGGCATTTGGAGCAAAGGAGTTAAATCCTCTGCAAGTAAAGGGAAATCACTC
ATATAAAACGAAAGAATTCAAGTTGAAATGACTGATATTACTGATGCTTCAAGATTCTTC
ATTAAAATCAACAATGAAAATCATTATGATAAGATTGAGAAATTGATGGGAAGCTTTGAT
TATTTGTCTGCTGATAATTTGGAAAGACCAATCAAGAAGAATACTATTTGCGCAGCTAGA
TTCAAGTTAGATGATAACTGGTATAGAGCTAAGGTGCTAAGAGGAGTCGGTAAAAATCAA
TATGAAGTTGAGTTCATTGATTTTGGAAACTCAGACACTGTAAATGGTGATGATCTCAAG
AGACTTACTCCAGAACTACTTGCAATTGAGCCAACCGCAAAAGAATGTTCTCTTGCCTAT
ATTAGAGTACCAAGAATGGATACTGAATTCGGTGAGGAAGCAGCAAAATTAATCTAATCA
TAAGCCATGGAAAAGGTAACAGAAGCCTTAGTTGTAGATTAACAAGGTGACAGATTAAAA
ATTGTGCTTTTCCCTAAGGGTGAGAAAGATTGGAGCAAGAGCATCAACTGTTTGCTTCTT
CAACAGAGTTTGGCTCAACTAGAAAAGTTTGATGAAGATAATGATGACTATCCAGAAGAA
ATAAATGACTGGTTTGATATTGAAGAAGAGCAAAGAGAGTTGCAAAATAAGATTTGGCAA
TATGGAGGTGCTGACGACGACGAAAATTGA


>Contig20252.0.g83(protein)
MVEKKEKVDKVIKGLVKAVFSGDYITITKSSKQHGPSDHNVYLASVQAPKIGSSTRVEEP
FAFEAREFLREKIIGKKAEFTNEYNYGGRDYGTLVVDGLNCNLAIVKAGLARVIEKKGAM
AASSHYEELVNAQSDAKSKGTGLWSSQDDKFLDKHTRKVTYFTDAGYNAPRLLEDAKKID
KPLECIVEYVFNCSYFSVFIHKFQTVIKLSLVHLFTPQTDKQLVDDGKRFVEKLILHRTV
GVKLERSEEGGTLVGRIYHPAGDIAYESLKGGYTKLNMPKNIDFDADYFKTLKEAQLIAQ
SKQARIWKDFKPEEQKQKQKASATDFTGKVVEIHTGDSLTIERESDLKQIRVFLATVKAP
LLNKKPGEDPDAYAWDSKEAMRKATIGKKVKVIMEFSKTVNERNMDFATVILDKTGKNVS
CILLEKGLLKTNVTKSGDNASKFIEDLLASEKKAVDARQGIFSNQPAPIRVFSDVVANPK
KAKDFEAMVMKRPNRKMNGVIEYCFSGMRFKVRLDGENTAIGLNLLGVRTMINDKNQPQL
MELSNEALAFAKEHLFQRDVVVEPDFADKRGSFFGTVTLTNKKDFALMLVQEGLAEVSII
GNKAPLNIEELENAQEQAKADKLGIWSKGVKSSASKGKSLIQNERIQVEMTDITDASRFF
IKINNENHYDKIEKLMGSFDYLSADNLERPIKKNTICAARFKLDDNWYRAKVLRGVGKNQ
YEVEFIDFGNSDTVNGDDLKRLTPELLAIEPTAKECSLAYIRVPRMDTEFGEEAAKLIQS
QAMEKVTEALVVDQQGDRLKIVLFPKGEKDWSKSINCLLLQQSLAQLEKFDEDNDDYPEE
INDWFDIEEEQRELQNKIWQYGGADDDEN