Identifiers and Description

Gene Model Identifier

Contig1167.0.g65

Standard Name

TCF19b

Aliases

Contig1167_0_g65

Description

BAH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010053003.0013534825799953e-36PHD-finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1167.0.g65(coding)
ATGAAGAATAATTCTACTAACCAGCAAGGAGCCAAGACTACAAAAGGGGAACCATAAAGC
TCGAAGAAATAGAAGGTCTACACTAAATTTCAGTACAAAGATTAGGTGTTCATGGTGGGA
GATGTGTGCAGGTTTTACAATGAATAAAGAGACTTAATCGGAAAAATCCTCTAAATAGCT
TCAACTGACTAGAACCACAAAGATTTCGGAAAATTGAAAGTGTAATGGTACTACTACAAG
TCAGATCTGAACTTTAAAAAGCTAGGAATAAGTGAAAAAGATTAGGCATAAATTTGCGAT
TAAGAACTATTTCCTACTACTCACACAGATCTGGTATACGTTTAGAGTTTGAATGGAAAG
TGCAATATCGTGACACTGGATGAATTTGAGCAACTAAAAGCAGCAAACAATGATACATTC
TTTACAAGAGCTGATTTTGACATTCATAGGAAAATACTCAAGCCAAGCTTTGATAAATGG
CCCAAAATATGCTCTTGTTAGAGACCTACTAATCCATAACAATTCTATATCTGCTGTGAT
TACTGCGAGAATTGGTATCATCCAGAGTGCTAAAACTCAACAGCTGTTGGAGATAACTTT
AAGTGCGATTAGTGTACTATGGGAGATTGA


>Contig1167.0.g65(protein)
MKNNSTNQQGAKTTKGEPQSSKKQKVYTKFQYKDQVFMVGDVCRFYNEQRDLIGKILQIA
STDQNHKDFGKLKVQWYYYKSDLNFKKLGISEKDQAQICDQELFPTTHTDLVYVQSLNGK
CNIVTLDEFEQLKAANNDTFFTRADFDIHRKILKPSFDKWPKICSCQRPTNPQQFYICCD
YCENWYHPECQNSTAVGDNFKCDQCTMGD