Identifiers and Description

Gene Model Identifier

Contig14261.0.g106

Standard Name

TCF19a

Aliases

Contig14261_0_g106

Description

BAH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010053001.000159011384939e-43PHD-finger family protein
SGDYPL138C0.00010003404299092957SPP1 SGDID:S000006059, Chr XVI
from 292427-291366, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14261.0.g106(coding)
ATGGAAAAGACAAAAGCTATTCAGAAACCTAAGAATGACATCTAAAAACAAAATAATTCA
AGCTCTTAAGCTAAGAAGAAACAGTATAAGAAGCTTTGCTTCAAAGATACTATTTATGAA
GTTGGAAATACTTTACTTTTTAAGGAGACTGAAAATTCAACTGTGATTGGAAAGCTGGTC
AGAATCATACCTGAGGGAGGTAACCCAGCACATCCTAAATGGCCAATGATTGAAGTCTAA
TGGTACTACAAAAAATAAGATTTGGATTTTAAAAAATTGGGAATTAGCGATGAAGATTAG
ACTCATTTCGGGTATAACGAAGTCTTTCCAACTAATCACCATGACAAAATTTACGTGGAT
TGTATCTAAGGAAAATGCTAGGTACATCACATAGACGATTATGACAAACTTGAGACAGTG
GGGGCAAACGTATATTTTACGAGAGCAAACTATAACCCCTTGCAGAAAATTCTCGACCCT
CCCTTCATTTAATGGGAAAAATACTGCTTGTGCTAGAAACCCCTTAATCCCAATAACTTG
TATATCAAATGTGATGGTTGTAATCAATGGTATCATCCCAAGTGTATGGGAATCTCGGAT
AGCGATGCTTACTAGACTGAGGACTTTTTCTGCGTTAAGTGCAGTGAGAAGCAATAAAAC
GCTAAAGAAACCAATTAAATATAGTAAAAATGA


>Contig14261.0.g106(protein)
MEKTKAIQKPKNDIQKQNNSSSQAKKKQYKKLCFKDTIYEVGNTLLFKETENSTVIGKLV
RIIPEGGNPAHPKWPMIEVQWYYKKQDLDFKKLGISDEDQTHFGYNEVFPTNHHDKIYVD
CIQGKCQVHHIDDYDKLETVGANVYFTRANYNPLQKILDPPFIQWEKYCLCQKPLNPNNL
YIKCDGCNQWYHPKCMGISDSDAYQTEDFFCVKCSEKQQNAKETNQIQQK