Identifiers and Description

Gene Model Identifier

Contig22142.0.g17

Standard Name

TCERG1

Aliases

Contig22142_0_g17

Description

FF domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam01846 ) FF domain
  • ( pfam12717 ) non-SMC mitotic condensation complex subunit 1
  • ( pfam03091 ) CutA1 divalent ion tolerance protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007558806.000034430729774e-56FF domain containing protein
SGDYKL012W0.000000000010004361180063202PRP40 SGDID:S000001495, Chr XI
from 418310-420061, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22142.0.g17(coding)
ATGTGTTAAATTTTTAATATTTAGAGTGGAATTACCGTATAAGATAAGCCAGCTGCACTC
AAGCAATAGGAAATAGACAGCTTGATGAGGCAGTAATAAGCTTAATAGTACGGGGGAGTT
CCTCTCACTCAGAAGCAGCAGGAAGATTTATCGTCGCTTTTTACACAGAGGAACCTCAAC
TTGCCAAAATAGTTAGGTAACCCTAACTCTAATTAGACTTAAATGTAGTCGCAAGCACAG
TTGCCTTACTATTAGCAGCAAAATTAGAATGCCTCATATCAAGGATTTGTGCCTGATTAA
TCAGCAAATTTCAATTAATAGCCAGGCTCTATGTCTCTTGACCCAGCTGATTAGTTCATG
AAAAAAGCTCTCGATACAGCTTTAAAGGGGGATATAGTGCGAGATATCTACCCAACTTTA
AACTACTTCAGAACTGAAGAAAGAATAACTGATAAAAAAGTCTTCCGCAGTTTCGACAAT
CTCTCAAAAGAGGATGCACTGCATGTTTTTAAGGAAGCATTGAGAGAATCAGGTGTTACA
GCATCGTGGAAGTGGGAAGATGCGAATAGAGTGGTCATGAATGATCCTAGAGTTAAAGCC
TTGAAAACCATTAGTGAAAGAAAGCAAGCATTTAACGACTACATCAATGAAATAAAAACC
AAGGAGAGAAATGATGCCAGAAACCGGAGATAGCAGCAAAAAGAAGGGTTTCTTGAACTA
CTAGGAGAGACAAAAAACTTGAACAGTCTCAGCAAATTCTACATAGCAGCGAAACAGTTT
CAAAGTGACTCAAGATTCAAGAGCGTTGAAGAGAAAGACAGAGAAGAGATTTTTCAAGAT
TACATTGACGAAATTATGACTAAAGAGCGAGAGGAGAAGAGAGAATAGGGAGAGAAAATC
GTTGAGAAATTGAAAGAGCATTTTACAAAGCTAAACATTCCTGGGTCTGCAAAATGGAAG
GAATTGATAACAAACCTCGCAGATGATTAGCTATTCAAATCAGCCGACACTCTTGAATAA
ATTACAGCATTTGAGGAGTACATCAAGGCAATTGAGAGATAAGAGTTTCAGACAAAGAAA
TTCGAGAAACGCCGCTAGGAAAGAAAAAACAGAGAAAATTTTGTAAAACTTTTAGAAGAA
AAACTTCAATCTAGAGAGTTGACACACAGATCCAAGTGGAAGAATTTTGTAAAAGAATTC
AAAGATGACTAACGATACACGAATCTCGTAGGATAGTCAGGATCAACAGCTCATGAGCTT
TTTGAAGATGCTCTCAATGAGGAAAAAGAATTATTGAGGATTCATAAACCGTCCTTCAAA
TCTCTCATAAAGGGAAGAGGCATAAGGTTTGCTAGTAATGTAGAGTTCTAAGCATTTGAT
GAGATATTAAGACAGTACTCAGAATATGAAAAGTTAGATAAAAAAGTTAAAGTGACTCTT
CATGAATATTATCTGTATAAAGTGAAACAAAAGGAATCAGAAAAAGCCAAAAAGTTGACA
AAAACATTAAGAAATTTTGAAAAATATTTGAAAAATATAGTCAATTTGTAAAAAAGTGAA
GTTTATTAAGACTATCTTCCTTGGATAGAAAAAGAAGGAGAATTTTCAGTTTTAACTGAA
GAAATTAAGCAAAAATCATTCACCGAAGTGGTCCAATTTATGAAGGATGAAATATTAAAT
AAATCTAAAAAGCGGTCGCGTAGTAGAGGAAAATAAACAAACAGGGATAGTTCAGTAGAA
TCAGGGGAACTCAAACTACCTTCTTAAACTGCTCGACATACCTAAAATGCATAATCAAAA
CAACATCGATGA


>Contig22142.0.g17(protein)
MCQIFNIQSGITVQDKPAALKQQEIDSLMRQQQAQQYGGVPLTQKQQEDLSSLFTQRNLN
LPKQLGNPNSNQTQMQSQAQLPYYQQQNQNASYQGFVPDQSANFNQQPGSMSLDPADQFM
KKALDTALKGDIVRDIYPTLNYFRTEERITDKKVFRSFDNLSKEDALHVFKEALRESGVT
ASWKWEDANRVVMNDPRVKALKTISERKQAFNDYINEIKTKERNDARNRRQQQKEGFLEL
LGETKNLNSLSKFYIAAKQFQSDSRFKSVEEKDREEIFQDYIDEIMTKEREEKREQGEKI
VEKLKEHFTKLNIPGSAKWKELITNLADDQLFKSADTLEQITAFEEYIKAIERQEFQTKK
FEKRRQERKNRENFVKLLEEKLQSRELTHRSKWKNFVKEFKDDQRYTNLVGQSGSTAHEL
FEDALNEEKELLRIHKPSFKSLIKGRGIRFASNVEFQAFDEILRQYSEYEKLDKKVKVTL
HEYYLYKVKQKESEKAKKLTKTLRNFEKYLKNIVNLQKSEVYQDYLPWIEKEGEFSVLTE
EIKQKSFTEVVQFMKDEILNKSKKRSRSRGKQTNRDSSVESGELKLPSQTARHTQNAQSK
QHR