Identifiers and Description

Gene Model Identifier

Contig7944.0.g15

Standard Name

TBRG1c

Aliases

Contig7944_0_g15

Description

F/Y rich C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008252803.0011595823640496e-94hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7944.0.g15(coding)
ATGTAAGCATCCCACTTATTGGGAGCAGAATCTGAGAAGAAATGGCTTGATTTAATGAAC
GAAAACATCCAGCATAAGAAGCAAGGATTTGGCTTTATTAGCAAATTTGACAAGAAAATA
TTTGCAAAACTCACCTCAGAGGAGTGCTAGAGTTACATGAGAAGCGGCAGCGGTAGCTTA
GTTGATAAAAGATACATTATTTCCAAATGTCAAACACTTGCCAAAGCTCTATGCTCATTA
GAATAAGATATTAAAGATAGCGTAATAAATATTATGACATTTGAAAGCCTCAAAATAAAT
GATGAGTTCTTCTTGCCAGGGTCCAAAGCTCAACTAAAGTCACTGGATAAAATCTAATTC
TTGTGTGAGAGTAACTGCAAAGTGCCTCATTTCTATCATGTAATTATTAGCGATGAAGTT
TCAATAAGTCTAGACAAAGGGCCTAACGAATAAGCTTATGTGCCTCTCTTAAACAATCAA
AGTGAACTTAATCAATCTAACAAGTTTAAAGATATCTTGAATCCTAAATTGCCAAAGCAT
CACGAAGCATGGACTAAAGAAGAGAAAAGATCTCTAAAAAGATTAATTTTAATGTTTGGT
TATGAGAGATGGTCAAAGATCAGGTCAATTTCAAAACTTAGTGATAAACTCATTAACAAA
AAATCAGATGACGAACTCAGAGCTTACTCAAATTACTTCATTATGCAGATTGCTGAGAGT
TTACAACATGACGAACTCTTCAAAGATATAATTAAGAGGTTGACAGATATAATCCAAATA
AAGCCTTATGATATTAAGATTGAAGCCTCTGCAAGTGACTTTGGTGATTGCTTTACTAGT
CAAGCTAAGTACTGGGCAAAGAGATTAATTCTACTTAATAACATGACACATTTGGTGAGA
TCATATAAGAATGCGTAACAGAAATTCAACTCATTACCAAACTTCAACTAGGATTAAAGA
CTGCAAAGACTTTACAAAGCAAATATAAACATTCTCAATTGTCTAAGTCAGGAAAAACTA
CAACCAGGGAAGCCAGCTATAGTTTGGACAAGAAAGCATGATGTTGATTTAATCTTTGGT
ACGTTCGAGCATGGCTTTGGAAATTATGAGAATATAATGAAAAATTAAAATTACATTTTC
TAAGATATTTCTTAGGGCAAGTTCAAATCAAATATGATGACCAAAAGATTGAAATATATA
ATTAAACTGGTGAACTAATACTTAAAGTCAAGCAACGGAAAGTATGATTTCGAAAAAACT
GATCATGTCAAGGAAGCTTCTGGTTTTTCCTTAGTAGAAAAGAATAAACTCTATGAAATC
TTGATAAATTATGGAGTGCCAACTATGTCATTGGAAGATGCAAGAGATGACTGGGAATTA
TTGAAAATATTGCTATCTAAACATTGTAAAGGGGAAGATGCTGAAACTAATTTAAATTTG
ATGTCAACTAAAATCATGAAGGACTATTAGAAGCCAGTTGCTGAAATCCTCGCTTAATGG
AAAGAAGAGGAAGAAAACGATAGTGACGAAGATGATGAAAATAAGTCCGAGAAATCTCTA
GATGAAAATGGAGAGAAGAAAGATGGCTCTAAAAAAGAAGAGGAGGTTAATGATTTCAAG
ATTGATAAAAAGAGAATAAGTGCTGCTCATGAATATGAAAAGACATGCTAGAGATTGGTG
TATGACCCAGATGCCGATGGATTCAACTTTGGATATGAGAGAGCGCTAACTTACAAAGTA
AGAATGAACATGTTCAAACTTATCAGAAAAGAGATCTTGGCTGGAAACTTCAGACTATTT
GAGTAATCACTCGAAAATCTCTCAGCAGTCCTAAGAGGGGAAAGAGAATTAAACAAAACT
AAGCTACCAGAAGAATGGATTTGTGACAAACATGATAGAAATTTACTAAAAGCAGTTAGT
GATAATGGGCTCTCTTATCTCAATAAAATGAAGGAAAATACTGACTATGGATTTGAAAAT
GTTAATGTTCCTAGAAAGAGATTGTAAAAGAGACTAGAGTTCCTCTGCTTATTCTTCAAA
GAATAATTAATGAAGCTTAGAAAGAACACTTCAAATGGAAGAGCAGGTGACCTATCCACA
GGTATAACTCAAATCGATCCAAAAAAGAAGTTTACAAAGATTGAGGTGGAAAGGGATGAT
CAAGGAAACATAAGATACCCAATTACAGTTTCTCCTACTCTTCAAATCTTCAACTTAGGA
ACTATTGAATGGGAAAGACCATTTTATCATTCTGAAAAAAACTTCTTCCCAATTGGTTTT
AAGAGTTTAAGAGAGTACACCTCTATGTTCAGAATAGGCGAGAGATGCTAGTACATTTGT
GAAATTTTGGATGGTGGAGTTAAGCCTATGTTCAAAGTCACTTGCTCAGAAGATCCAGCA
AATCCTATAATTAAAGATTCTTCTTCTGGAGTTTGGATCGAAATTTGCAAAAAAATCAAT
GATTTATCTGGCAGCAAGAGAACTAATGTAACAGTGAGTGGGCCTGATAGATATGGTTTA
GCAGAACCAGGAGTCAATTAGTTGTTACAATCACTCCCTAACTCAGAAAAGTGTCAGAAG
TATAAATTTATTTTCTGA


>Contig7944.0.g15(protein)
MQASHLLGAESEKKWLDLMNENIQHKKQGFGFISKFDKKIFAKLTSEECQSYMRSGSGSL
VDKRYIISKCQTLAKALCSLEQDIKDSVINIMTFESLKINDEFFLPGSKAQLKSLDKIQF
LCESNCKVPHFYHVIISDEVSISLDKGPNEQAYVPLLNNQSELNQSNKFKDILNPKLPKH
HEAWTKEEKRSLKRLILMFGYERWSKIRSISKLSDKLINKKSDDELRAYSNYFIMQIAES
LQHDELFKDIIKRLTDIIQIKPYDIKIEASASDFGDCFTSQAKYWAKRLILLNNMTHLVR
SYKNAQQKFNSLPNFNQDQRLQRLYKANINILNCLSQEKLQPGKPAIVWTRKHDVDLIFG
TFEHGFGNYENIMKNQNYIFQDISQGKFKSNMMTKRLKYIIKLVNQYLKSSNGKYDFEKT
DHVKEASGFSLVEKNKLYEILINYGVPTMSLEDARDDWELLKILLSKHCKGEDAETNLNL
MSTKIMKDYQKPVAEILAQWKEEEENDSDEDDENKSEKSLDENGEKKDGSKKEEEVNDFK
IDKKRISAAHEYEKTCQRLVYDPDADGFNFGYERALTYKVRMNMFKLIRKEILAGNFRLF
EQSLENLSAVLRGERELNKTKLPEEWICDKHDRNLLKAVSDNGLSYLNKMKENTDYGFEN
VNVPRKRLQKRLEFLCLFFKEQLMKLRKNTSNGRAGDLSTGITQIDPKKKFTKIEVERDD
QGNIRYPITVSPTLQIFNLGTIEWERPFYHSEKNFFPIGFKSLREYTSMFRIGERCQYIC
EILDGGVKPMFKVTCSEDPANPIIKDSSSGVWIEICKKINDLSGSKRTNVTVSGPDRYGL
AEPGVNQLLQSLPNSEKCQKYKFIF