Identifiers and Description

Gene Model Identifier

Contig7944.0.g14

Standard Name

TBRG1b

Aliases

Contig7944_0_g14

Description

F/Y rich C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008252809.001992589090134e-64hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7944.0.g14(coding)
ATGCTAAAATTTTACAAAGGCAAATTGAAGATGCTGGGTAAAGCATGTTGCAGTATTTTC
AGAGTGAAACTGGGCAGCAAAACATGCACACAATTGCAGATTTAAATTTTGATAAAATCA
GGAAAGTTTAATACTGTAAATCGAAAGTACATGTTGGATGCCACATTTCTTTCATGTCGT
CTACCCAGATAATAATTAGAAACCAGAGTAGCTCCAGGATTAAGATGGCTTATGTTTAAA
CGGGAATAGTGGCAGCTAATCAGAGATTCTTCAAAAAATAGTGGGTGTAACATTGAAGAA
AAAGCCGATGAAGAAATGATCCTCTATGCTAATTCCTTCATTTAAACTATCATAAGTCAG
TTAAAGAACTAAGAGACTAAAGAAGTGAAGGAATTTTTAAGTAATTTAATTGAAGAGAAC
CAATTTGAAGCAACATTAGATTCAAACTTATAAATGTGGGGAGGTGAATCCTTCGTTCTC
AGAGCTTAATAATGGGGAAAGCGTATTCAGCTTTTGTATGTAGTAACTAGAATAGTTAGA
GCTTACAAAGAGAAACGAAGGACTTTCTTGGCATCAGACTCTCAAGACAAACTTGATTAG
CGTCTCTATAAAGCTTATAAACTCAAAGAAAACCTGTTAAATTTTATATCAAATGATTAA
TTGGTTGGAATGAAGCCAGCTTAATGGTGGACTAGAAGATTTGATATTGACCTTATTCTG
GGAACCCACAAATGGGGATATGGTAATTATTAAGTAATGAGAGAAGACTAGAAGCTTAGC
TATTGTAAAAATCCAAAGAATGATCCATACTACCAATTTCCTTAAGCTGAATAAGTAACC
AAAAGATTAAAGAAATTAGTACAGTTAATAAGTAGAGTGGAAGGAGAGTTTGATTTCGAT
GGTCAGATTAAGCTTAGTGAACATTCAGGTTTCAATCTGGAGGAGAAGAATGCAATAGTT
GAAGTAGTTTGCGATATTGGAATACCTATAGGATCAGATGAAACAAAGAAGTCAGACTTT
CAACATATTCGCAATAGAGCTTCCATGATTTTAAATCGAATAATGACTTAGCCAGATCAT
AAAATAGAGAAATTTCTGAATTTCATACAATCAGAGTGCTAGAAGTTAACTACAGAGTAT
AGTGGGCATCTACAAAGAATAGGCTATAAAGATTTAAACAAAGAATTAAATGACTATAAA
GTCCTTAAACCAAAGCAATTAAGATTAGATTTGTTCGAGAATCAGGGTCAAGAATTATAC
TTTAAAACTGATGATGAAGACGATTTTAGAGTTACAATAGATATTGCCTTTAAAATTAAC
AAAAGAGTGGCATTGTTCAATTTAATAAGGAAAATTATAATGAGTAATCAAAATTAACTA
TTTGATGCCTGTATTGATGATTTGACAGAATTGATAATAGAAGAAAGAGAAAAGGATGAA
TGCTACTTACCAGTAGATTGGCTAGTGGGTATACATGATAGAGGACTACTAAATGCTATA
AGTGAGAGAGGAGTAAGCTACCTTAAATAAGCAAAGCAAGAACATGAGTTTGGGTTATAT
GCAATTACTATAAGTTCAAAAAAGCTTTTAAGGCGTGTTGAGTTTTTATGTCATTACTTC
AAAACTCTTCCGTAAAGAGGGTAAATTCTAAATCCTGAAAGATAGTCTGCAATTAAAGCA
AGCATGTTAAGTATTTAAAATAAACCAACTTAAAAAATCAAAATAAATATTGATAGTGAT
GCAAACGGAAATATCAAATACCCAATTGAAATCAATTAAAGTCTGAAGATCTTGAATTTA
GGCTATATTGATAACGAGAGGTAAAATTATCACTCTCACAGAAATTTATTTCCAATAGGC
TTTAAAACAATCAGAACTCATTAGAGCCTTTTTAACTTAGGAGCTAGGGCTGAATATATT
TGTGAAATTCTAGATGGCGGAGAAAGACCTCTATTCAAGGTAACACCAGCTGAGGAACCT
GATAAGCCAATTATAAAGGACAGTACTTCTGGATGTTGGCTTGAAATAGTAAAAAGAATT
GAGAGCATGACTAACATTAGAAAAGGAAAAGTCACAGTAAGTGGTCCAGATAGATATGGA
CTACAAGAACCAGCTGTAATGCAACTCATTTAATAATTACCAAATGCAGATAAATGCTAA
AGATATCAATTTAGATGA


>Contig7944.0.g14(protein)
MLKFYKGKLKMLGKACCSIFRVKLGSKTCTQLQIQILIKSGKFNTVNRKYMLDATFLSCR
LPRQQLETRVAPGLRWLMFKREQWQLIRDSSKNSGCNIEEKADEEMILYANSFIQTIISQ
LKNQETKEVKEFLSNLIEENQFEATLDSNLQMWGGESFVLRAQQWGKRIQLLYVVTRIVR
AYKEKRRTFLASDSQDKLDQRLYKAYKLKENLLNFISNDQLVGMKPAQWWTRRFDIDLIL
GTHKWGYGNYQVMREDQKLSYCKNPKNDPYYQFPQAEQVTKRLKKLVQLISRVEGEFDFD
GQIKLSEHSGFNLEEKNAIVEVVCDIGIPIGSDETKKSDFQHIRNRASMILNRIMTQPDH
KIEKFLNFIQSECQKLTTEYSGHLQRIGYKDLNKELNDYKVLKPKQLRLDLFENQGQELY
FKTDDEDDFRVTIDIAFKINKRVALFNLIRKIIMSNQNQLFDACIDDLTELIIEEREKDE
CYLPVDWLVGIHDRGLLNAISERGVSYLKQAKQEHEFGLYAITISSKKLLRRVEFLCHYF
KTLPQRGQILNPERQSAIKASMLSIQNKPTQKIKINIDSDANGNIKYPIEINQSLKILNL
GYIDNERQNYHSHRNLFPIGFKTIRTHQSLFNLGARAEYICEILDGGERPLFKVTPAEEP
DKPIIKDSTSGCWLEIVKRIESMTNIRKGKVTVSGPDRYGLQEPAVMQLIQQLPNADKCQ
RYQFR