Identifiers and Description

Gene Model Identifier

Contig8457.0.g63

Standard Name

TBRG1a

Aliases

Contig8457_0_g63

Description

F/Y rich C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008252807.000167904290908e-152hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8457.0.g63(coding)
ATGATGTAAATGAACACCCACGAAACTTTCTATGCCAAGTTTCAATCAATCGCTGAGGCT
TCCGTTTTTGTCAAATATTTGCCCTGTTTAATTGGAGGTGAATCAGTGTTGAAGACTCGC
GTCCAGCAGTCAAATGGAGGGAACCCACAAAGCCAAAACTTTGCAATAAATTTAGAGGAC
CCAGAATACCAGAAGTGCGAACCTAAGACAAGGGAATTGCTGAAAAATGATGAGGTTAAG
TATAAACTTCATCTATCATCCTGTTCCTCAATATACAATGTTGATAGGGAAATCTACGAA
ATGATGGCATTAAAGCCATTTTCACTTAATGATAAAGAATTGTTTATTGAAGATGGTTAT
ACTCAGGTTAACTCAATGGATAAAGTATACATTCCTTGCAATAAATGCTACATTCCTCAC
TTATTCTACTTCATTTTGCCTCTCAGAGAAACAATTACCTAGTAATTCAAAGAAGGAGCA
TTAGCTTAATCTAAGAATATGTCTTCAAACGCACAGGCAGCCAGTATTGATGAGAAGCTA
GGTTAGATGATGAAAAAGATACCAGACAAGGCACTCCAATAAAAATGGGGTAGCATGGAA
AAAGAGACTTTAAAGAAATACTTGTTACAGTTCGGCTATGGAAGATGGAGAAAGATTAGA
AAATATAGCAAGAATCATGATAAGATTCTTAAGGACAAGTCTGATTTGGAGATGAAGGCT
TTCTCTAATGACTTCATAAGAACTCTTTTTGAATTTTTGCAAAATGAGAAAAATGAACTC
AAAAACTTCTTGATTAACTTGATTGATGAAAGACCTGAAGATCCTTTCGTTCAAAGCTAG
CCAAAGGAATGGGGTGAATAAATTAGTCAAAGAGCAGCACCTTGGGCAAAGAGAATTTAA
CTCTTGCATAGAGTAAAGGGCCTGATTGAAACTTACAAGAGTGAGAAAAAGAAGTATTTC
GCTAAATCAAATGAGGACCAAGATCCATAAATCAAACGTGATTATGAGACTTGGGATAAC
TTATTAAACTTTTTGCCTGCCTCAGTATTTTATGGCCAGAGACCTTCTGTATGGTGGACA
CTCAGACATGATATTGATTTGCTATTTGGTACCTATAAATATGGTTATGCGATGTACCAG
GCTATGAGAAATGATAAAACACTCAGCTTTCATAAAAGTGAGCAAGTGGAAGGTTAATAT
TAAGAATTTCCAAATGCTGACAATATCACAAGAAGACTCAAAAAGTTAGTTCAAATTATC
GGCAAGAGTGAGTATTAATAAGGCCTGTCCTTCGAAAAAGCAATGAACGCTCAAGAACCA
ACAGGTTTCACCCTTGATGAGAAAAATATGATTTATGAGATTTTGATTAACGTGGGTGTC
CCAGTAAACTCAGAGGGAAAGAATGATTATGGCTTCATAAGGAATAAGTTAGTCAAGCCT
GACGAAGAAGGTGTACAAAACCAAGCTTAACCAGAAGAAATCAAATAGCAGCAGGACTAA
CCTATGGCAGACACCACTAACATGCAGCTCACAGCTATTGATGATTAGAACAAAGAGGGA
GAAAGAAATACAGCTTAGAATTTGGAGAGATTCATCTAAAGACTTAGAATGGTATCTTAA
TAAATAATTTAATCCCATTAGCAAATGAATGCTCAATAATCTTAAATTGAAGAAGAAAAG
GTTAATCTCATAAAACAAGAACAAGATGAAGATTTAAATGAAGAATCAAAGCAACTAGAA
GAAAAGAAAAAGTTTGAATAGCAAGAGAAGTAACCTATTTCCACAAAATCAAGAATCATT
AATTTTGACCCTGATGAAGATGGTTTCAATTTTGGCTATGAAAAAGCTTGTATTATTCAT
AAAAACATGAACATTTTACAATTTATTAGGAAAAACTTGCTATTAGGAAATGGAAGATAA
TTCGAAACAGGACTTGAGGCTTTGTAAGAACAATTCATTAAGGACAGAAATTAAAATGAG
TAGATGGCAGATATTGATGAAAACACAGTAAATAACGAGGAAAAATTGGCTTAAATTCTA
CCTGAAAATTGGTCGTGTGAAAGACATGATAGAGGAGTTTTGACAGCAGTAAATACTTCT
GGATTTGAAGCATTATAAACTCTTTCAGGAAACAAAGACTTCGGTTTTGAAGATTTGGAA
ATATCGCCAGACCTTGCCTTTAAAAGAGTTGAAGAAATTTGCGAGTTCTATAAAGAATTC
TAATAGCAATCAAGAGTAGTGAAGAAACCAAAGAAGGAGACTGCTAATGCACCCGCATAA
TCTGCTTAGCAAACGATTAAGTAGGAACAAGTATAATAATAAATGGGATCAAATGAATCT
GGTCAAATAACTCAGTAAATAACTAATGCAGAACCTAGAAAGAAGGTAGCCAAAGTTTAA
GTGCAGAAGGACGAGGAAGGTTGTATCATCTATCCAATTGTGATAAATAGCTCACTATAA
ATATTGGACCTTGGTTTAATTGAATACGAGAGAAACTAGTACCATACAGAAAAGAATCTC
TTCCCTATTGGCTTCAAAAGTTAAAGAGAGCATAACAGCTAGTTGAGAGTTGGAGAAAGA
TGCCAATATATCTGCGAGATTCTTGATGGAGGTCAGAAACCATTATACAGAGTCACCCCA
ATGGATGACCCTGAGAATTCTATAACTAGGGAGTCTTCAACTGGTTGCTGGATTGATATT
TGTAAGAAGATAAATGAACTACAAGGAAATAAAAGATCTACTGTCACAGTGAGTGGTCCA
GAAAGATTTGGATTGGCTGACATAAATGTGATTAAACTTATGTAATAATTGCCAAATGCT
ACTAGATGCCAGAGATATCAATTAAGAGCTGATTTATGA


>Contig8457.0.g63(protein)
MMQMNTHETFYAKFQSIAEASVFVKYLPCLIGGESVLKTRVQQSNGGNPQSQNFAINLED
PEYQKCEPKTRELLKNDEVKYKLHLSSCSSIYNVDREIYEMMALKPFSLNDKELFIEDGY
TQVNSMDKVYIPCNKCYIPHLFYFILPLRETITQQFKEGALAQSKNMSSNAQAASIDEKL
GQMMKKIPDKALQQKWGSMEKETLKKYLLQFGYGRWRKIRKYSKNHDKILKDKSDLEMKA
FSNDFIRTLFEFLQNEKNELKNFLINLIDERPEDPFVQSQPKEWGEQISQRAAPWAKRIQ
LLHRVKGLIETYKSEKKKYFAKSNEDQDPQIKRDYETWDNLLNFLPASVFYGQRPSVWWT
LRHDIDLLFGTYKYGYAMYQAMRNDKTLSFHKSEQVEGQYQEFPNADNITRRLKKLVQII
GKSEYQQGLSFEKAMNAQEPTGFTLDEKNMIYEILINVGVPVNSEGKNDYGFIRNKLVKP
DEEGVQNQAQPEEIKQQQDQPMADTTNMQLTAIDDQNKEGERNTAQNLERFIQRLRMVSQ
QIIQSHQQMNAQQSQIEEEKVNLIKQEQDEDLNEESKQLEEKKKFEQQEKQPISTKSRII
NFDPDEDGFNFGYEKACIIHKNMNILQFIRKNLLLGNGRQFETGLEALQEQFIKDRNQNE
QMADIDENTVNNEEKLAQILPENWSCERHDRGVLTAVNTSGFEALQTLSGNKDFGFEDLE
ISPDLAFKRVEEICEFYKEFQQQSRVVKKPKKETANAPAQSAQQTIKQEQVQQQMGSNES
GQITQQITNAEPRKKVAKVQVQKDEEGCIIYPIVINSSLQILDLGLIEYERNQYHTEKNL
FPIGFKSQREHNSQLRVGERCQYICEILDGGQKPLYRVTPMDDPENSITRESSTGCWIDI
CKKINELQGNKRSTVTVSGPERFGLADINVIKLMQQLPNATRCQRYQLRADL