Identifiers and Description

Gene Model Identifier

Contig9118.0.g56

Standard Name

TBP1b

Aliases

Contig9118_0_g56

Description

Transcription factor TFIID (or TATA-binding protein, TBP)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • regulation of transcription, DNA-templated (IEA) | GO:0006355
  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( pfam00352 ) Transcription factor TFIID (or TATA-binding protein, TBP)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER148W9.998074580622396e-81SPT15 SGDID:S000000950, Chr V
from 465303-466025, Genom...
T. thermophilaTTHERM_005753505.999266750653237e-78TATA-box binding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9118.0.g56(coding)
ATGAAGCCATCCCAACAACCCCCCACAGGAATGCTGATAAAGCCTAGGACACATCATTAA
TCTGTTAACATTAATGGCATAGGCTAAAATTCCAAGGACAACCTTTTTGGTACTCAGACT
GATAACTTATCCACTGTTGGATCCACAAAAGAAGGAAATTCTTTAACTTCTGGTGTTTAA
ACACAATCAACTGCAGCAAGTTCTTAGTTTTATCCAAGCTAGGCATAGCAGCAATCTTAG
TATAATATGAGACTCTCATAATACAACACTTAAAATGCTAATACTGCCATGATAAATACT
AATTCCCAATAATCATCGTAGTTGTTTGGCAACCCTAATTTTTAGTCTTAATAAAATAGA
GTGCTAATGGCAAATACGATGACAGCAAATAGCAGCCAATCGCAAGCCGCCTCTAATTAT
AATCTTTTTCAACAAAAGAAATATTAGCCTTTATAAGGCATGTCAAGTGATTAATCTTAA
CTACTACTTAATGGTAATATGAAAACATCTTCAAACGTTGCAGTTGGTAACTCGTTGCCT
AATAGTTTAGTTCCAAACCTTGCAGCTGTCACTTCTTAGTAGTATCCCTCAGTGAATAAT
AGTAGTTAGTTCTAAATACCTGCAGTCACTATGTAGCATAAGCAAAATCTGCTTAATAAC
TATAACAACTATTCTTAATTCAATGCTCAGTAACGATCATAGTAGATTGCTTAAAATGTA
TCAAGAGCTGGAATGAACCCTTCTTCTCTGATGTCACAAAATTATAATCCACACTTAGCT
CCAATGCTGAATAATGGTCAACCTTAATCGATCTTAAAGCAGCCAAACTTCGCTCAAAAC
TCTGTACTAATTAAACCAGAATAGAACTTGCCTGAATCACTTCTAAATGGGGACCCAACC
TTATAGAACATAGTGGCAACTTGTAACTTTGGCTGCAAACTCGACTTAAGATAAATAGCT
CTTAATGCAAGAAACTGTGAGTATAATCCTAAGCGTTTTGCAGCAGCTATCATGCGTATA
AGAGAACCAAAGACAACAGCTCTAATATTTCAATCTGGTAAAATGGTATGCACAGGTGCT
AAGGACGAAGAAAAATCGAGAACAGCTTGCAAGTAATATGCCAAAGCTGTGAGGAAGATA
GGCTTCAACGTTTAGATGAAAGAGTTTAAGATCTAAAATGTAGTAGCCTCCCATGATTGC
GGATTCCCCATTAGTCTTGAAGGATTAAGCAACGAGCATGATAAGTTCAGCACTTATGAA
CCAGAATTGTTCCCAGGTTTGATCTATCGCATGGCCTCTCCAAAGCTTGTAATGCTAATA
TTTGCAAGTGGGAAAATTGTATTCACTGGAGCCAAAACTAGAGAATAAATTAGAGATGCG
TATCGAAACATAGATCCAGTTCTAAGAAAACATAAAAAGAAGGGATTAGCTGCTGAAAAA
TTCTAAAAGTAAAATGTTGCCAAAAATCAGTCATTACTAATTAATATTAAGCATAAGACT
TAGTAATGA


>Contig9118.0.g56(protein)
MKPSQQPPTGMLIKPRTHHQSVNINGIGQNSKDNLFGTQTDNLSTVGSTKEGNSLTSGVQ
TQSTAASSQFYPSQAQQQSQYNMRLSQYNTQNANTAMINTNSQQSSQLFGNPNFQSQQNR
VLMANTMTANSSQSQAASNYNLFQQKKYQPLQGMSSDQSQLLLNGNMKTSSNVAVGNSLP
NSLVPNLAAVTSQQYPSVNNSSQFQIPAVTMQHKQNLLNNYNNYSQFNAQQRSQQIAQNV
SRAGMNPSSLMSQNYNPHLAPMLNNGQPQSILKQPNFAQNSVLIKPEQNLPESLLNGDPT
LQNIVATCNFGCKLDLRQIALNARNCEYNPKRFAAAIMRIREPKTTALIFQSGKMVCTGA
KDEEKSRTACKQYAKAVRKIGFNVQMKEFKIQNVVASHDCGFPISLEGLSNEHDKFSTYE
PELFPGLIYRMASPKLVMLIFASGKIVFTGAKTREQIRDAYRNIDPVLRKHKKKGLAAEK
FQKQNVAKNQSLLINIKHKTQQ