Identifiers and Description

Gene Model Identifier

Contig262.1.g32

Standard Name

TBP1a

Aliases

Contig262_1_g32

Description

Transcription factor TFIID (or TATA-binding protein, TBP)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • regulation of transcription, DNA-templated (IEA) | GO:0006355
  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( pfam00352 ) Transcription factor TFIID (or TATA-binding protein, TBP)
  • ( pfam11858 ) Domain of unknown function (DUF3378)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005753503.99873325818918e-82TATA-box binding protein
SGDYER148W1.0003926095686843e-81SPT15 SGDID:S000000950, Chr V
from 465303-466025, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig262.1.g32(coding)
ATGGATAATGTTAGTGGTATTGAGAAAGAACTCAATAAGTTAGGGTGTGCTAATGCGACT
TATAAGTCAGAGACCTAAAGTAAGGTTTCTGAGAAGGGTTAAAATTAAATATCAACTTAA
AATTCTGAGAAAAATGCTCTTTCAACAAAGAGTGGTGAGGCTTCAGGAACTCGTCAGACT
TCGAATGGAGGCGCTCACCTATCACAGGATGTTTCAATGAATGGAAGTTAAAATCAAGGA
AAAATGGGATCATCTGGAAGTGGTCTGATGGGTGCATAGATAGACATGAGAGTCAAACAA
GAATAGAGAAAAGACTCAGGTGCTTTCAATGGCAATCAAATGAGCGACAGAGGATCGCAT
CACTCTGGTTAAAGCGGAGCAGGAGGCTCTCATTAATTTTATGGAAGTAACAAGCCTGAT
TAATCCAAGTACATGTCTTCTTCCTCAGGTCATCCAAGTGCTGGTATGATGCTCCCACCA
GGTCAAAGCTACTCCAACTCACCTTTTCCAAATATGTCTGGCTAAAGACTTGGTTCTTAA
GTTCCCACTATTGGTAAAGACGGAAGGCCAACATCAATTCCACCCTCTGGTATGATGCCC
AACAGAATGATGAGTGGCATGCCCGGCTAGGGACATCCTCACCCTATGTTTCAGAACAGC
TAGGGAGGTGTATTAAGACCATAACCAATGCCAGGTGCTCCATTTCCAATTGGAGGAGGT
CCAGAGAATCAAGCCAGAATGGAAATGTATAGACCAGGACCTTATCCCCCAAATATGATG
CCTACTTAAGGACCAAACGGCATGATTAATAGCTCTCCAATGATGCCAAACTAGCTAGCT
AGAATTCCTTAATAAATCCCACCAAGAACCGGTAACTTCGTCCCAGCTTTGCCACAGCCC
TCAGTCTCCGCAGAGAAAATTCCCCAACCAATCTTGCAAAACATAGTTTCAACTGCAAAC
CTAGGCATGAAACTTGATTTAAGAAAAATTGCAATGAATTGTCGTAACGCTGAATACAAC
CCAAAGCGTTTCGCTGCCGTCATTATGCGTATTAGAGATCCAAAAACAACTGCCTTGATT
TTCAGTTCAGGTAAAATGGTGTGCACAGGTGCTAAATCCGAGGAGTTCAGTAGAGATGCT
GCTAAGAAATACTCAAAAGCCATCAAGAAAGTTGGCTTTGAAGATGTGAACATGCAGGAT
TTCAAGATTTAAAATATTGTTGGCTCATGTGATGTCGGTTTCCCCATTTCACTTGAAAGT
TTGTCAAGCACTCATGAAAAGTTTTCGCAATATGAGCCCGAAATCTTCCCAGGCCTAATT
TACAGAATGGCCACACCCAAGATTGTCCTGCTTATCTTCGCTAGTGGTAAAATCGTTCTT
ACTGGTGCTAAGAACAAGAACGACATCAAGGAAGCCTATGAAAACATCTATCCAGTGCTC
AAGAAATACAAGAAAAAGAATGTGAAACCAGTAACTTAATAATCCCAATCCGCAAGAATC
TGA


>Contig262.1.g32(protein)
MDNVSGIEKELNKLGCANATYKSETQSKVSEKGQNQISTQNSEKNALSTKSGEASGTRQT
SNGGAHLSQDVSMNGSQNQGKMGSSGSGLMGAQIDMRVKQEQRKDSGAFNGNQMSDRGSH
HSGQSGAGGSHQFYGSNKPDQSKYMSSSSGHPSAGMMLPPGQSYSNSPFPNMSGQRLGSQ
VPTIGKDGRPTSIPPSGMMPNRMMSGMPGQGHPHPMFQNSQGGVLRPQPMPGAPFPIGGG
PENQARMEMYRPGPYPPNMMPTQGPNGMINSSPMMPNQLARIPQQIPPRTGNFVPALPQP
SVSAEKIPQPILQNIVSTANLGMKLDLRKIAMNCRNAEYNPKRFAAVIMRIRDPKTTALI
FSSGKMVCTGAKSEEFSRDAAKKYSKAIKKVGFEDVNMQDFKIQNIVGSCDVGFPISLES
LSSTHEKFSQYEPEIFPGLIYRMATPKIVLLIFASGKIVLTGAKNKNDIKEAYENIYPVL
KKYKKKNVKPVTQQSQSARI