Identifiers and Description

Gene Model Identifier

Contig13385.0.g45

Standard Name

TATDN3

Aliases

Contig13385_0_g45

Description

TatD related DNase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004753199.997751616309157e-110conserved hypothetical protein
SGDYBL055C4.999934616708877e-52YBL055C SGDID:S000000151, Chr
II from 116829-115573, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13385.0.g45(coding)
ATGTAAACTAAAAAATAACCAAAGCAATAGCAGAAACCCAAGGAGTAGCCAAAACCATAA
GCCCCTCTACGCGACTATTCTTAGATAAAACTCTTTGATATTGCAGCAAATTTGTCAGAT
GATAGGTACAAGGGAGTGTACTATGGAGGGAAGCTTCATGACCCTGACTTCGATCTAGTG
ATTAAAAGAGCAAATGATTATGGAGTGAGAAAGTTCCTTTTCGCTTCAGGCTACCTCCAT
GACGCAGAAGATTCGTACAATCTAGCCCTGAGAAGTGAAGATTTTTATTGTACGGTCGGA
GTTCACCCTTGTAGAGCAACCGAGCCATTTAAGGTTTAGAGTCAAAATTCCTCTTCAAAT
TCAAATGATGAAGTAGTTAAATCAACTTCATTAACAGATAATCAATAAGTTAAACTGCCT
AATGAAGAAGAAAAAGACAACACAACTTAAAGATAAGAGATAAACAAAGAGGAAATGCTG
AAAGATTATATGAGAAGAATAGATGAGATGCTATGTACTAAAGAAAGAAAAGAAAAGTTT
GTCGCTATAGGGGAGTGCGGGCTTGACTATGACAGATTTGAATATGCCGACAAAGAAACT
CAGTTAATGGTATTCCCGCCTCACTTTGATTTGGCTTAAAAGCATAATTTACCCATGTAT
TTACACTCAAGAAATACTGATGGAGATTTCGCAAGAATTGTGAGAGAAAATAGACATAAA
TTTTCCACTGGCGTCGTACACTCTTATACTGGAGACCTAGAAGAACTAAGAGAATTACTA
GATATGAATCTATACATCGGTCTCAATGGATGCTCTTTGAAAACAGACTAAAATATGGAA
GTTGTGAAATAAATACCACTCGACCGCATTATGTTAGAAACTGACTGCCCCTACTGCGAT
ATTAGAAATTCACATGCCAGCGCTAAACATGTAAAAACTTAATTTGCCAAAGTTCCAAAA
GACAAGTACAAATGTGGAGATAAAATGAACAAAGATAGAAACGAGCCTTGCACTATGATT
TAAGTAGCAGAAGTTGTCTCACATCTCTTAGGTGTCTCTGAAGAGGAACTCATGCAAGTG
GCATGGGAAAATACTGTGAATATGTTCAACTTAAAAGAGTGA


>Contig13385.0.g45(protein)
MQTKKQPKQQQKPKEQPKPQAPLRDYSQIKLFDIAANLSDDRYKGVYYGGKLHDPDFDLV
IKRANDYGVRKFLFASGYLHDAEDSYNLALRSEDFYCTVGVHPCRATEPFKVQSQNSSSN
SNDEVVKSTSLTDNQQVKLPNEEEKDNTTQRQEINKEEMLKDYMRRIDEMLCTKERKEKF
VAIGECGLDYDRFEYADKETQLMVFPPHFDLAQKHNLPMYLHSRNTDGDFARIVRENRHK
FSTGVVHSYTGDLEELRELLDMNLYIGLNGCSLKTDQNMEVVKQIPLDRIMLETDCPYCD
IRNSHASAKHVKTQFAKVPKDKYKCGDKMNKDRNEPCTMIQVAEVVSHLLGVSEEELMQV
AWENTVNMFNLKE