Identifiers and Description

Gene Model Identifier

Contig20982.0.g60

Standard Name

TARSc

Aliases

Contig20982_0_g60

Description

tRNA synthetase class II core domain (G, H, P, S and T)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam03129 ) Anticodon binding domain
  • ( pfam07973 ) Threonyl and Alanyl tRNA synthetase second additional domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001946509.997093137033517e-262threonyl-tRNA synthetase famil
y protein
SGDYIL078W9.997093137033517e-262THS1 SGDID:S000001340, Chr IX
from 212499-214703, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20982.0.g60(coding)
ATGTAGGTTAGGTATTTGGACCCAAAACTCAGAGCAGCTACTAATTTATTTGATCCAGAT
TAAACAGCAGAGAATGAAACTTTACAAGATATTTCAAATTAGTGGCAGTTGATAGACGTA
AACAGACCTTTGCTTGGGGATTGTGAACTATAGCTCTTAAATTATTAAGAGAATTTAAAG
GAAATTTAATCTTCATTTTGGCATTCATCTGCTCATATTCTTGGCTATTCTATTGAAGAG
ACATACAAAGATAGTTTGTTAACAATGGGACCTCCAATCAAAGATGGATTTTACTATGAT
TTCCAAACTTAGTAAGTAGTTACAGAGAAAGATTACAAAACTCTTGAGTCTTCAATTAAG
TCTATAATCAAGAAGAATCTTGATTTTGAGCGTTTAGTAATTTCTAAGGAAGAGGCTCTT
GACATGTTTTCATATAATAAATTCAAAACCCATCTCATTGAAAATAAGGTGCCTGACAAC
GCTATGACAAGTGTGTATAAAATAGGCGATTTCATAGATCTATGTACAGGACCTCACTTA
AAATCTACTGGTCTTGCTAAGGGCTTTGCTATAACAAAACATTCTTCAGCATACTGGTTG
GGAAACTAGAAGAATGAATCACTATAGAGAATTTATGGCATTTCATTTCACGAAAAGGAG
GACCTTAAAGAATATGAACGAATTAGGCAAGAATCTCTTAAAAGAGATCATAGAGTTCTT
GGATAAAACTAAAGTCTGTTTTTCTTTAGCAAATTTTCTCCAGGGAGCGCATTCTTTTTA
GCTCATGGTACAAAAATTTACAACAAACTTGTGGACTTAATGAGAACTGAATATCTTAAG
AGAGGGTATCAGGAAGTGATCTCACCCAACTTATTCCACATTGATTTGTGGAAGACATCT
GGCCATTACAAAAATTACAAAGAAAACCTATATTTAGTAAACACCAAAGATCAGTGTCAT
TCTTAAGACTCCTTGCATTAACATGAAGCTTTTGGCTTGAAGCCTATGAATTGCCCAGGA
CATTGCTTGATCTTCAAAAATTCAACTCATTCCTACAAGGAGCTGCCAATTAGATATGCT
GATTTTGGAGTTCTGCATAGAAATGAAATAAGTGGAGCTTTATCAGGACTTACAAGAGAT
CAGATTGAATAAGAGATAGAGGGCTGCTTAAACTTCTTAAACAGTATTTACTCTTTGTTT
GGGTTTAAATGGGATATATTCTTGAGTACTAAGCCTGAGTCTTCAATGGGCAGCGATGAA
CAATGGAGTGAAGCAGAAACTTAACTATAAAATGCCTTAAATAGAATGGGTAAGCCTTGG
AAACTAAACAAGGGAGACGGTGCTTTTTATGGACCGAAGATTGATATAATTATATATGAT
ACTCTTGGCAGAGCGATTCAATGTGGAACAATTTAACTTGATTTTTAACTTCCTATTAGA
TTCAATCTACAATATAATACGTCACATAATCAACTTTAAGAGGAAGGACTTAATCATGAC
AATAGTGAATAAAATACAGTAGAGCTTGCTAGTGAAACTTTTGATATTGATGAGCACAGT
CCTTAAAAGTTTGAATGGAAAGAATAACCTCTTAAGAGAGGTCACGAGCGACCAGTAATT
ATACACAGAGCAATTTTAGGATCAGTAGAAAGATTTATCGCAATTTTAACTGAGCATTTA
GCTGGAAAATGGCCTATATGGTTGTCTCCAAGATAAATCTGCATTTGCCCAATTTCAGAA
AAGCATTTAGAGTACTCTACCTAAGTGTATGAATAGCTGAAACAAATGGGCTACGAAGTT
GAAATCGAATTATCAAACTCAAGTATCGGTAAGAAAATTAGAAATGCACAACTAAATTAA
TTTAACTTGATTTTGACTCTGGGAGACCAAGAAGAATAAAGTCATACTGTGGATATCAGA
ACTAGGGAAGGAGATTAATTGGGAAAAATGAACTTAACAGAGCTATAAACATACATTAAC
AAGTAATATCCACCAGGAGTTCCACTTCCTCAGAAACTTTTCAATTAAGACTTGAAATGA


>Contig20982.0.g60(protein)
MQVRYLDPKLRAATNLFDPDQTAENETLQDISNQWQLIDVNRPLLGDCELQLLNYQENLK
EIQSSFWHSSAHILGYSIEETYKDSLLTMGPPIKDGFYYDFQTQQVVTEKDYKTLESSIK
SIIKKNLDFERLVISKEEALDMFSYNKFKTHLIENKVPDNAMTSVYKIGDFIDLCTGPHL
KSTGLAKGFAITKHSSAYWLGNQKNESLQRIYGISFHEKEDLKEYERIRQESLKRDHRVL
GQNQSLFFFSKFSPGSAFFLAHGTKIYNKLVDLMRTEYLKRGYQEVISPNLFHIDLWKTS
GHYKNYKENLYLVNTKDQCHSQDSLHQHEAFGLKPMNCPGHCLIFKNSTHSYKELPIRYA
DFGVLHRNEISGALSGLTRDQIEQEIEGCLNFLNSIYSLFGFKWDIFLSTKPESSMGSDE
QWSEAETQLQNALNRMGKPWKLNKGDGAFYGPKIDIIIYDTLGRAIQCGTIQLDFQLPIR
FNLQYNTSHNQLQEEGLNHDNSEQNTVELASETFDIDEHSPQKFEWKEQPLKRGHERPVI
IHRAILGSVERFIAILTEHLAGKWPIWLSPRQICICPISEKHLEYSTQVYEQLKQMGYEV
EIELSNSSIGKKIRNAQLNQFNLILTLGDQEEQSHTVDIRTREGDQLGKMNLTELQTYIN
KQYPPGVPLPQKLFNQDLK