Identifiers and Description

Gene Model Identifier

Contig4674.0.g42

Standard Name

TAF9

Aliases

Contig4674_0_g42

Description

Transcription initiation factor IID, 31kD subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02291 ) Transcription initiation factor IID, 31kD subunit
  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam07524 ) Bromodomain associated

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR236W0.000000004999139696582238TAF9 SGDID:S000004849, Chr XII
I from 742971-743444, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4674.0.g42(coding)
ATGGAGGGCAAATCATCACAGAAGATGGATCAACCAACCAAATCTGGAGGAGCAGGTGGA
TCAAGTGGAAGTTAACAGAGAAAGCAGCAACCAGGTGGATCAGATCCTAGCCACAGACAA
GCTAGAGAGATCAAACCTCAAATGGTTTAAGTCATTGAGAAGCTACTTGAGAGATAAGCT
ATTGAGCATTATGAGAAGAATGTAGTGAATTAAGTTCTTGAATTCATGCATTACTATGTG
ACAGAATTGCTGCAAGAAGCTAAGATCTACAAAGAGTATGCCAACAAGCGCTAAATAGAT
GTGAATGACATAAAGTTAGCAATTCAGAGTAAAAGCTACAACTCATTCACAAGACCATTG
CCTATGAGCATTCAGAAGTAAATTGCCAACACCAAGAATCACATTCCTATCTCAAAGAAT
GATGATTAGGCGTAAACTCAATCAATGGGAGGTGCAGCTGGATCAGGTGGATTTGGAGTT
ACTGGAGCTGGTCCAGGTGCAATTGGTATGGGTGGTATGCCAGGCTAAGGTATGTCTCAG
CTGAAAATGTCTACACAGAGAATCTAAGAACAATTGCAACAAAGATTACCACCAAATGAG
TATCTTCACATGAATCCTAATGTGCAAATCTACTCGGAGGAGATTCAGAAGAAACTCGAA
AGCTAAGACTATTACGCCCACAGGCACAGACAGCAACATGAGGAGGAACAACAGAGAGCT
ATTCTTATGAGGCAACAGGCTATGTAGTTATCAGAGAACAAGCAGCAGAGGATACTCAAT
TCAGACATGATAAATGATGTCAAGAGACCTGGCTAGTACCAGCAGTAAGTCAATGACTCA
GGCATCATGAACAGAACTGCAGCCACTCTCAGAAACAATTAGTCTTAGAGTTTAAATGCT
AGTGGCATGATTCAATTTGACTATTAGGTCCCACATGCTTCAGTAGCTAACAGCAATGAA
ACATTCTACTAAGATGAGTTCGAAACTATTTCCAAGAAGCACAATGAGTTCCACCAACCA
TCACATAATTCAGGGTACTATGACGACACAGTTAATCAAATTATGGACTTCAAACAAAAC
TAAGTGAAGGATTCTGGAAATGTAAATTTCGGGGGTGACTACCCTATGCAGGAAAACTAA
CCAGCTTACATTATGCAGTAGCAACCAAACTAGATGTATAATCCACAGCAAAACAGACAC
ATCCCAGGGGCTATGGATCAGATCAACTTTGAAGAGGAAGATGAAGAGGGCGGTGAGACC
GACTAAAAGAATGATGAGTGGGTGAGCAATGAGGAAGATGACGACGATGATGCTCTTTTC
AATGATAAGTGA


>Contig4674.0.g42(protein)
MEGKSSQKMDQPTKSGGAGGSSGSQQRKQQPGGSDPSHRQAREIKPQMVQVIEKLLERQA
IEHYEKNVVNQVLEFMHYYVTELLQEAKIYKEYANKRQIDVNDIKLAIQSKSYNSFTRPL
PMSIQKQIANTKNHIPISKNDDQAQTQSMGGAAGSGGFGVTGAGPGAIGMGGMPGQGMSQ
LKMSTQRIQEQLQQRLPPNEYLHMNPNVQIYSEEIQKKLESQDYYAHRHRQQHEEEQQRA
ILMRQQAMQLSENKQQRILNSDMINDVKRPGQYQQQVNDSGIMNRTAATLRNNQSQSLNA
SGMIQFDYQVPHASVANSNETFYQDEFETISKKHNEFHQPSHNSGYYDDTVNQIMDFKQN
QVKDSGNVNFGGDYPMQENQPAYIMQQQPNQMYNPQQNRHIPGAMDQINFEEEDEEGGET
DQKNDEWVSNEEDDDDDALFNDK