Identifiers and Description

Gene Model Identifier

Contig19222.0.g62

Standard Name

TAF7

Aliases

Contig19222_0_g62

Description

TAFII55 protein conserved region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( pfam04658 ) TAFII55 protein conserved region
  • ( pfam01934 ) Protein of unknown function DUF86

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR227C0.00000039992052383199455TAF7 SGDID:S000004840, Chr XII
I from 724385-722613, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19222.0.g62(coding)
ATGGACATCATCAATCTAGACCCTGCTAAGAAAATTTATGGTCTTATCGTAGACAACAAA
ATTTTCTTGGCTTCTCTTTGTGAGTTGCCCAATATAATTGAGGGTTAGAAAACTTTGGAC
TTCAGAACTTTCTACAAGTCAGTGGATGTATCCCAGATTCTATACATTCATAATAAAGTG
ATTGAGGACTATCAATAGAAATCGCCAGAAGAACTTGTGAAAATTGCTAAGGATTACAAT
CCAGTGCTTGAAGACCCAGACTTCTTGAATAGTCTCTATCGTAAAAGTGAAACTAAGAGA
ATGGTGGAAGAGTAAAAAGTCAGAGAAGTAGAAGTCAAATATGACATACTTAAGTTTAGA
CATGGTCTCGCACCTGTTGCCAAAAACATCAGAAATATAAGACACAAAAAAGAGCCTAAT
GAAGATCCAGATGAGGTACACGCAGTTGAGTAGATTCTTAAAGACATCATTGATTATGGT
TTCGCTGATAACGTGGAGGAAGAACTTTTGGAATTTGATGATAATGGAGATTTGAAAAGT
TGTGTGAAAGGAGCCAAAGAAAAGAGAAAAGAACAAGTAAATAACAATTTGATCTAGATT
GACTATCTACTTGATCCAAGTGCTAGAAGTGAATCCAATTATCAAGGGTAATTTCAATTT
GCCGCAGATGGCCAATCGAGTATGTACTCAGTCCCTGTTGATTAATTTGATGACGGAACT
TCTTACCGCTAAGATACCGTTTACAATGAAAATTAAGGTTAGGACTAGGAGTAATCACAA
ACTTACCCCTAAATCTAAATTTAAAGAAATCAAAGTAGCGCTCCACTAAATCAAAGTGAA
TCTTATCAGCAAAATCAGTTTAACCAACCAAACATGTCTGGCTAAGCAAATTTCAGTGCA
AGTCAGTTCTTGAATCAGTCTCATTAAAATATGCCTTCTTCTTATAATCAAACTCCTACC
TTTGATCAGATAAACTAGTAGTTCTAAGCTTAGCAATTCTAATAAGACGATGTGAACATG
TCTTACCAATAAAATCAATAGACCCTATCTTCTTCCACTTCTCAACAAATTACCTAGTTC
GATACAAGTCAGCCATAAGCCTTTTAATAATCCTAGATACCAACTAATGAGCCTATTTAC
ACTTACTAAGATTACATATAAATGAAGCAAGATCTCAAAGAGTTAAAGAAATTGATTAAA
ACAACAAAGAGCGACATACAGGAGAGCTAACAGCAGGGGGTTGATATTACAGAACTCAAA
TCTTACTATCGATAACTATGCCAGCACAAAGATGAAATAAAATCTTAAAAGAAAATAGCA
AAGAGACAATTAAAGAGACTGCAATAGCAATAGTAGGCTATGCAGTAGTGA


>Contig19222.0.g62(protein)
MDIINLDPAKKIYGLIVDNKIFLASLCELPNIIEGQKTLDFRTFYKSVDVSQILYIHNKV
IEDYQQKSPEELVKIAKDYNPVLEDPDFLNSLYRKSETKRMVEEQKVREVEVKYDILKFR
HGLAPVAKNIRNIRHKKEPNEDPDEVHAVEQILKDIIDYGFADNVEEELLEFDDNGDLKS
CVKGAKEKRKEQVNNNLIQIDYLLDPSARSESNYQGQFQFAADGQSSMYSVPVDQFDDGT
SYRQDTVYNENQGQDQEQSQTYPQIQIQRNQSSAPLNQSESYQQNQFNQPNMSGQANFSA
SQFLNQSHQNMPSSYNQTPTFDQINQQFQAQQFQQDDVNMSYQQNQQTLSSSTSQQITQF
DTSQPQAFQQSQIPTNEPIYTYQDYIQMKQDLKELKKLIKTTKSDIQESQQQGVDITELK
SYYRQLCQHKDEIKSQKKIAKRQLKRLQQQQQAMQQ