Identifiers and Description

Gene Model Identifier

Contig922.1.g114

Standard Name

TAF5

Aliases

Contig922_1_g114

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR198C2.9997246065828143e-59TAF5 SGDID:S000000402, Chr II
from 618523-616127, Genom...
T. thermophilaTTHERM_002271604.999350823993609e-33conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig922.1.g114(coding)
ATGGATGAGTGCATCATCCAATATGTTGAATTGAGGGGTGATAAAAAGACTGCATAGCAA
TTAAGAGATAAATTTGTGAATGAAGTTGATGAAGCAACAGAAGTATTGCAACAAAGCGGC
GATTTTCCCACATACGCCCTTAACAATATTAAAAGTTTTACTCTCACTGCGAGTGCTCTA
TTTGGAGGTGGATAAAATTTGCAAACTTCATAAAGCATGCAAGCTGTATTTAATGGAGAT
TCTCCAGATCACTACACAGAGTCCTTCAAACTGCTGAAAAAATATATTGAGCAATCTCTA
GATTAATACAAAGAAGATCTCTAAAGCAACAATTTCATTGATTAAGCGAGAGATTTTTTT
AATGAGGAAAAGTTCATGTTTATAGCCACAGAAAGAGAAAACTTGAATATTTTAGAGCAA
GTTGACTCTATAGCCAAACTTGCAAATGCTGAAGTTTAAAACTTTATCAACAACAAATTT
ATGGTTAAGATGTCAGTTTATGCTTCTCAGCTCCTCATGCACTTCGTAAAACTTAACCAA
TTTATTTTGATTATGCATATCTTGAATCAAAATATCACATTTCAACTCTCTGGTGAGAAA
AATATTGTGGATATGAAAGGACTGTAAAGCTATCTAATATCTGACAATATTCAGGAAATC
AATAAAACTGAGCTAGTTTTGGGTAAACTCCCTCAATTCAGCCCAGAATACGCTTTTTAA
AATTAATAGGTTGCTGCACTTGGTCAAGAGAATCCCATATAGTAAAATCTTGGTCAGGGA
CAAACTGGTATTGCATAAGATGTGTTGCAATAAAAGGTACAAATAATTTTAAACTTAATT
CTTTTTCTTAATTAGAAAATGAAAAGGCAAGCTCAAAACATTTTGACAGAAACTCAAATT
CCAATGCCGAGAATAGAGGATGAATTGCAGTAGAAAATATTCTTTGAGTTAAATTAATAA
GTCAAATTAGGAGACAAGAGTTTACCCTCTATTGCTTGCATTTCACTTTAACAAACTTAC
AGACTATTGACAGCTGTCACATTGAGTCAAAGCTCAAACCTTCTCGTTTGCGGATTTTAG
GACAGTTCTATAAAAGTCTTTATATTAGATTAAGGCAAAAATGATGCAGTGAGTATCTAT
GACGTAAAGCAAGAGTAATATGAAAGAATGAAAGCTATGCAAAACGGTGGATAATAAATC
AGTCAACAAAATCTTTAGTAAAAGAAAAAGGTAGCTAATCCAGGAAGCTAGACAATCAGC
CTTAAAGAATCTAAACAAGATATAGAGGAAAGAAAATCTCAAAGTGAGTTTGTTCTATTA
GGTCACTCTGGCCCTGTCTATGGATTAAGCGTTCTAATTGATGACAAAACTCTTCTATCT
AGTTCTTTTGATACAACAATTCGCCTTTGGTCTTTGCAATAGAAGACTTTAATAGGAATA
TTTCACGGTCATAATTTCCCAGTTTGGAATGTATAATTCTCTCCACTTGGAAGTTATTTT
GCTTCTTGCTCTAATGATAGAACTGCTAAAATTTGGTAAATAAAGCAACATGTTCCCATT
AGAATATTCGTTGGTCATCTTTCAGATGTTGACGCAATTGAGTTCCATCCAAATATTCAT
TACTTAGCTACTGGCTCAAGTGATAAGCAAATTAGATTATGGTCATTCTTAACAGGTGAG
TGCGTGAGAATTATGCTTACAGTTGCAGGAACTATAAGAAGCTTAAAATTCACAAAAGCT
GGTAATCATTTAATCGCTGGAAATGAATATGGAGAGCTTGTGATATTTGACATAAACAAG
GCGATTCCCCTTGAAATCATTTAAACTTGCCAAAGCAAAGCAATCTGGACTATCGACGTG
AGTTGGGATGACTAAATTATTTCTATTGGAACTGAAGATTCTACTATTGAACTCTACAGT
CTATCAAAGATTCTAGCTCAACAAGGCAAAATTGAATAATATTAGCAAACTGCTAAGATT
CCAGGCAAAAGCTCTAGCACCTCATTCCTGAAAATGTATAAGACCAAAGCCAACGGAATA
CTAATAACCTAATTTACATGGAAGAATTTCTTATATGCAGTTGGATAGATTATACTAGCT
TAAGAAGACAAGATTAAAATTGTATCTGATTTAGCTTTTGATGCAGTCGATCTAGATGGC
TCTGGATTTCTAGAGAAAGACGAGCTTGCAGAAGTTATGAAAAACGTGGCATATGAAATG
AAAGTAAAACCACCTACAGATGGAGATATAGATGCAGTCCTGAGAGAATTAGATGAAGAC
TATGATGAAAAAGTATCAAAGGATGAGTTTGTACAACTTATTATATAAGTCATGAAAAAA
ATGCTTGAGTCAGAGGAAGATTTGTAGAAATAAATCAACTCCTAGGTAAAGAAGTAATGA


>Contig922.1.g114(protein)
MDECIIQYVELRGDKKTAQQLRDKFVNEVDEATEVLQQSGDFPTYALNNIKSFTLTASAL
FGGGQNLQTSQSMQAVFNGDSPDHYTESFKLLKKYIEQSLDQYKEDLQSNNFIDQARDFF
NEEKFMFIATERENLNILEQVDSIAKLANAEVQNFINNKFMVKMSVYASQLLMHFVKLNQ
FILIMHILNQNITFQLSGEKNIVDMKGLQSYLISDNIQEINKTELVLGKLPQFSPEYAFQ
NQQVAALGQENPIQQNLGQGQTGIAQDVLQQKVQIILNLILFLNQKMKRQAQNILTETQI
PMPRIEDELQQKIFFELNQQVKLGDKSLPSIACISLQQTYRLLTAVTLSQSSNLLVCGFQ
DSSIKVFILDQGKNDAVSIYDVKQEQYERMKAMQNGGQQISQQNLQQKKKVANPGSQTIS
LKESKQDIEERKSQSEFVLLGHSGPVYGLSVLIDDKTLLSSSFDTTIRLWSLQQKTLIGI
FHGHNFPVWNVQFSPLGSYFASCSNDRTAKIWQIKQHVPIRIFVGHLSDVDAIEFHPNIH
YLATGSSDKQIRLWSFLTGECVRIMLTVAGTIRSLKFTKAGNHLIAGNEYGELVIFDINK
AIPLEIIQTCQSKAIWTIDVSWDDQIISIGTEDSTIELYSLSKILAQQGKIEQYQQTAKI
PGKSSSTSFLKMYKTKANGILITQFTWKNFLYAVGQIILAQEDKIKIVSDLAFDAVDLDG
SGFLEKDELAEVMKNVAYEMKVKPPTDGDIDAVLRELDEDYDEKVSKDEFVQLIIQVMKK
MLESEEDLQKQINSQVKKQ