Identifiers and Description

Gene Model Identifier

Contig12727.0.g81

Standard Name

TAF2

Aliases

Contig12727_0_g81

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR252W0.00000000006996681903814525GCN5 SGDID:S000003484, Chr VII
from 996869-998188, Geno...
T. thermophilaTTHERM_002192000.00000019998969434520019Bromodomain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12727.0.g81(coding)
ATGCAACCAAACTAATAACCAAATTATCAGTATTAGCAAGATTAGTTCGGTATTGTTGAT
CTGGGAGCCAACAATGTAAATGGAAATAATACCAATTTACTTAGCAACTAATATTAAGAT
CAGTAAACTTTCTAGCAATTCGCAGTCCCAAATGCTTAATACATGCAGGATAGTTAGGTA
TTGGAGTAATAAAACTATGACATGGAAGACGATGAAGAAATGGAGCAGGACTACGACGAC
GAAAATGCAGATGATTAGGACGACGACGATGACGATGAAGACCTCGACTTGGTAGCACTG
GCAGAGAGATAGAGGCAGCTAGGTTTAGCAACAGGACAGCCTGCTTCAAATAAAATATCG
ATATCAATTGGGGCTCCAAGGACACAACCTCCTCAAACCCTTCTATCAAATCAAATCCCT
ATCTAAATACCAATGGGTTAACCATAAAATTCTTATACAGCATAAAATACTCAACCAATT
AATCAATATTAAGCAGCAAATTAACCAATAGTATTCTTAGAATCATAGTCACCAAGGGAA
GAGGAATTTATCAATTAGGAAGCTAATAAAATTAATACTGATTATTTCCCTTTTGATCAA
TAAATAGTGCATCAGGATCAAGAATCATAATAATAATAGCCTACAAATAAAATCAAGATT
TCTTTTGGAGTACCTCCTCCTTAAATAACACAAAACTAGAAATTATTATTGGTAAAACCT
GATGAAGGCTAATCTTAAATCACAATTCCAAGAGTTGAGGAAGCTCCACAGCAATTGAAC
GATCAGTTCAAAGTATCATTAACTAATTAAAACCAATTTTAAGCATAAAACACTCAACCT
CTTCATTATGATTAAAACATAATTTAGCCAATTAATGATATTTAGTAGCAGTATCTACTT
TAAATTTAATAAGAAGAGCAAGCTAAGATGGAAGATTTAAGCATAAATCTGTAACCTTAA
CTAAATCAACCTGATTAAAATTTAGGACAAGAATAAATTCGATTAGTCACTCATATACCA
TAATAATAATAATACTCCAGTAATTTGATGCCTGATTAAACTCAATTGGATAACTAGCTA
AATTATCAAAATCATCAGCAATTCCAATTTGAATAGCAGCAACAATTTTAAGAGCAAAGT
CCAATCCCAAAGGAAAGTATTTAACCTCCAAAGTTAAAATCAGAGAAAAAGAAGAAAAGA
AAGAAGAAGGGAAAAGGTTCATTTTTGGATTTCTACGGTTTGGATAAAACTAAACTTACT
ATAGAAATAGATCATATAGAGAAGAGAATGCGTGCATAAGCATTATTCACTTTCATATTA
AAAGATCATGAAATTGTTACTTAGAAGCTTTAATCAATCGAGGAACAAAACTTCAAGAAA
TATGTGCTTGATCTCGGCATTCATGCTAAGCAAATGTCCATATTTGGAGTTTATCAATTA
GCAGGAGAAGACAACAAAGAAAGAATACCTACGAGCTTTGAGTATCCTGGTCCTGAAGAG
TAAGCCAAATTTCTAAGGACTGCATATGAAAACTTAAGTAAAGATTTGCATACATTTGAA
ACTTAGTAGCAATAAATCTATGAAAGTCAGTAGAAGGAACCTCTACTTAAGATAAAAGGC
TTAATTAAATTGAAATGTGGAGAGGAAAATTTGATAGAGCAATTCCAACCTAAAGTTAGA
ATTTTAGTAGAGTATTATCTTGAAAAAGTTACTAATTTTGGCATTTAAGTAAATAAATTT
AAACAATCTTATGACTAAAATGGATAGTCAATTGAAGATGTAGAATCAAATTATTTTTAC
ACCTCAGATTAAATTGATAATAATGAGCTTTGGATGCCAATCATTGAAGGCATGAAGCAC
ATTCCAACTAGATTCATAATAAACTATTTAGCTCCCAAGAATTACTTTGTAGTTTCGTCT
GGAAAACTTATAGACAAGTAAATAGAAAAAGATTGCTTACAAAGAACACTTTTTGTTTAT
CACTTAAATGACAATGACAAATGTATTCCCGATAAAATAGGTTTTATCATGGCAAAATTT
ACTAATATTTACAGAATTAATGACTTAAATGAAATATGTACTGGAGGAGCAACTGTTCTC
TTCACATCTCCAAAAAAGCATGAATCTTTTGCTGTTAATAAGATTTATGAGAAAAATATC
ATTCAGATTATCAGCTACTTTTAAAAGTTAATCTAAGCTCGATATCCTTACACATCTTTA
AAGCTAGTATTTGTGCCAAACTTAATTTTGAAACAATCAAGGAAGTAAAGTTTAGATTTC
GCTGGTGGTCTTCACATCTTAGATGAAGAACTAATTTTCAATAGAAATTAACTTGAAAAT
AGGAACTTCACTTATAAATATTTGGCTTCTTCCCTCGCATTTGACTTCTTCGGAGGTAAG
GTTTTTGAAGAGACTCCTGAAGATTGGTGGTTACTTTAAGGTTTGAGGGAAAGCCTGGGA
AATCATTTCAAAATATCAAAGTGTGGCATATTGATATATAGGTACAACATTATGTAAACT
ATTTAAAAGTTGTACAAGCAAATGAAATATGGATTTGAAAGATTTCCATTATCAAGCTAG
CATTATCCCCATCCCTCTGAATAGCAAATGAATGATATAGTTTACTAGAAGTGTGAGCTT
ATTATGCATATGATTGAGTCTATGATAGATAAGTCCTATTATGAACGCATCATAAGATAA
ATTTATGACTCTGCTAACCCCACTATCTCTCAAGGTCTTTTCCATAATATTTTCAAGCAA
GTATGTGGTTTTAAGCTAAAATAGTTCTTTTAAAACTGGATTATATCTACATCATGCCCC
AAGTTAACAGCTAGTTTCAATTATAATAAAAAGAACAACTCCTTGGATTTGAATATAGCT
TAAACTTCCGCAATGAAATCATACTTTTCTTACAAGAGATTCACAAAGAATCTAATTGAA
ATGAAATAAATCTTTTCACTTCCATCATTCTCATTCAAGCATATCAACTCTGCAATGGCT
AAGTAAAATCAAAATGTAGATAGTTTTCTTGTTGAACTGAAGCGAGGTTGTATGAGGTAT
TTCACTGGAGAAGTGAATGTGATGATATATCTCACAGATGGTGCTGAGATACAGACTTAG
CAACAGAAAATGAGTTTAAGGTATGGCAAAAGTTAAGTGAGTGTGAACATTCCTCTCTAA
TGTAAAGTTAAAAAGACGATTCAAAACAAAAAGAAGGAATATGAAAATATGTTAATGTAT
GACTAGGAAATGCATTAAGATGATGAAAGAGGAGATGATAATATGAATAATAATGGCTAA
AACGATCATCATATGATTGACAACATGCAATGGAAGTTTGGCCTCAATGATTTCGAGTTA
GAAGATTATCCATACGGCACTAAGAACCTCTTTGACGTTAAAAACTTGGAGTCCCCTGTG
CTATGGATTAGAGTTGATCCAGACATGGAGTTTATTAGAAAGGTGAAAGTTGTTCAAGAG
TAAAACAATTGGCTCTTTTAGTTACTTCAAGAAAAAGATATCATCGGTCAAATCGAGGCA
ATTAATGAGCTTAATAAGTTCAACTCTGAATTAGTTTATGAAATACTGAAGTCAGTGAGT
ACCAATGAAAACTACTTCTTTAAAGTTAGAAAGATAGCAATTAAGAAACTGTAATAAATG
CAAACTTCACAATTCAACAAGTATTTATCTCATGAGAAATTCTTGATTAAAGTGTTTAAT
TAGAGAAACTTTGATAAGTCGATAGGATTTTACAAGTCAAATGATTTCAGCAAAGTCTTG
GAATACTATATTGATAAATCTATTCTAAAAACCCTCTCTAAATGCAAAGAAGTTCCCTTA
GAGTTGAAAGAAGAAATAAAAGAGTACCTATTAAACTAGTAGAAGTAACAATAAAATTAG
CCTAATGAGTCAGCTACTCAGCCACCAGGAACGATATCAATCAATATTAGCAGCAATGAA
GTTGTTCAATAAAAGTAACAGAAGTTAAATTCAAAGTATAACGAGAAATATTTCAATGTC
TCCTCTGAACAAATTGGATAGCTACTCATGAGATTGTTGCAAGAAAATGATAATTCAGAG
AATCCATTCGATGATAGTTTTTATATTAAGTAGATATTAAAGGCTTTAGGAAATCTAGAC
TGTTTCAAACTTTTACCTGAGATAGCAACTGAAATTTATAGACAATATAGATTGGATTAT
ATTGGTAAATATTCTCCCCAGTTTTCTATAACTAAGGGTTCTATAGCTGGTTACTTCAAG
CTCAGAAAGCAAATATTTTTATTCAAAACAGAGAAAATTAAGAATATCGATACAAAAATT
GAAAATGTAGATTGGTATCTAGATTAAATAGACCTTGCAGAAAGATAAACATTAAATTAG
ATGGGCAGTGACTTAGATAAAATGATTGAAGACGATCTTTGGCCCTATGAAAAAGCCTTA
TATATCCAATTGAAGAAGTGCGAAGAATATTTAACTAAAACTAATTATAAATATGGAACA
GACTTGATTAAGCAAATGGCAATGTTTTTGGAAGCAAATTAAGATATTTTGGATTTCAGA
GAATGTTATTTGGACAATGATAAATCTAAGGGAGTGACAGAACTACTTTGGAATATGTTA
CTTTTACCATTCAATTTCTTAAATGCTGAATTCACATACTGGCTTAAGCGTCTTTACTAT
TTCATCTTTGGAAATGAAACACCACTTTTCTTTAAAGAATAGCAAACCAAATAAGGATCA
AAGAATGAAGTAATGCAGTATGATGAGTATTGGTCAAGAATCGAAGATTAGCTTGCTGAT
GCAAATGCTCTAATGCAGCAACAAAATGACGATAAAAATCAGCATTTAAAGTAAATATTG
GCATAGAAGCAGAGCACTAAGGTCGTAGTAGGAATCCCTAATACTGGTGTAACTCAAAAG
AGCGAAAAGATTGTCATTTAAGATTTAGGGTAAAAGCAACATGAATAGTAACCTGAATCA
AAGCTTAAAATTGTTCTAGCCCCATTCTTTGGTGAACAGACTAAGCAAAGTTGGAATCCA
TCAGCAAACTAAACTCAAGAAAAAAGTATTAAAATCGTATTAGGTGGTCTATAAATAGAA
CCATTCAAGTCTAATACTTACTCTCAAGATTAATAAATGAACCAAATGAGAGAAGAACAG
AACTAACAGATTTAACTTATGCAGTCATTGAGTCACTAACCTATCGCCTAACATTAAATC
AATTTAAGTAGTGACTAGTACTACGATGCTGCTCAATACGATGACAACGAATCAGTTTAT
GACGAATTTGCTGAAATTAAATTCACCGATACTCCGTGGTTGCAGGCTGCTTGGGAAATC
CTAGGTACACTATGGTATCATGAAGAAGCAGGAGCTTTTCTGTCTCCAGTCTCTGAAGAT
GATCTTGGCTCTTACTTTGAGGATTATTTAAGGACCATCGATTATCCTATGGACTTATCA
ACCATGAAGCTTAAAGCAATTGAAAGGCTTTACAGGAATTTCTAAGAATTCAAGAGAGAC
GCTTTAACAGTGTTTAGGAACTGTCAAAAGTTTAATCACGAGTCCAGTGAGATACATCAA
GCATCTGTGAAACTTGAGAATTTCTTCAAGAGAAAACTTCTCGAATATTAGAGATTTGAC
CAAGCTATTATAAGAATTAGTTGA


>Contig12727.0.g81(protein)
MQPNQQPNYQYQQDQFGIVDLGANNVNGNNTNLLSNQYQDQQTFQQFAVPNAQYMQDSQV
LEQQNYDMEDDEEMEQDYDDENADDQDDDDDDEDLDLVALAERQRQLGLATGQPASNKIS
ISIGAPRTQPPQTLLSNQIPIQIPMGQPQNSYTAQNTQPINQYQAANQPIVFLESQSPRE
EEFINQEANKINTDYFPFDQQIVHQDQESQQQQPTNKIKISFGVPPPQITQNQKLLLVKP
DEGQSQITIPRVEEAPQQLNDQFKVSLTNQNQFQAQNTQPLHYDQNIIQPINDIQQQYLL
QIQQEEQAKMEDLSINLQPQLNQPDQNLGQEQIRLVTHIPQQQQYSSNLMPDQTQLDNQL
NYQNHQQFQFEQQQQFQEQSPIPKESIQPPKLKSEKKKKRKKKGKGSFLDFYGLDKTKLT
IEIDHIEKRMRAQALFTFILKDHEIVTQKLQSIEEQNFKKYVLDLGIHAKQMSIFGVYQL
AGEDNKERIPTSFEYPGPEEQAKFLRTAYENLSKDLHTFETQQQQIYESQQKEPLLKIKG
LIKLKCGEENLIEQFQPKVRILVEYYLEKVTNFGIQVNKFKQSYDQNGQSIEDVESNYFY
TSDQIDNNELWMPIIEGMKHIPTRFIINYLAPKNYFVVSSGKLIDKQIEKDCLQRTLFVY
HLNDNDKCIPDKIGFIMAKFTNIYRINDLNEICTGGATVLFTSPKKHESFAVNKIYEKNI
IQIISYFQKLIQARYPYTSLKLVFVPNLILKQSRKQSLDFAGGLHILDEELIFNRNQLEN
RNFTYKYLASSLAFDFFGGKVFEETPEDWWLLQGLRESLGNHFKISKCGILIYRYNIMQT
IQKLYKQMKYGFERFPLSSQHYPHPSEQQMNDIVYQKCELIMHMIESMIDKSYYERIIRQ
IYDSANPTISQGLFHNIFKQVCGFKLKQFFQNWIISTSCPKLTASFNYNKKNNSLDLNIA
QTSAMKSYFSYKRFTKNLIEMKQIFSLPSFSFKHINSAMAKQNQNVDSFLVELKRGCMRY
FTGEVNVMIYLTDGAEIQTQQQKMSLRYGKSQVSVNIPLQCKVKKTIQNKKKEYENMLMY
DQEMHQDDERGDDNMNNNGQNDHHMIDNMQWKFGLNDFELEDYPYGTKNLFDVKNLESPV
LWIRVDPDMEFIRKVKVVQEQNNWLFQLLQEKDIIGQIEAINELNKFNSELVYEILKSVS
TNENYFFKVRKIAIKKLQQMQTSQFNKYLSHEKFLIKVFNQRNFDKSIGFYKSNDFSKVL
EYYIDKSILKTLSKCKEVPLELKEEIKEYLLNQQKQQQNQPNESATQPPGTISINISSNE
VVQQKQQKLNSKYNEKYFNVSSEQIGQLLMRLLQENDNSENPFDDSFYIKQILKALGNLD
CFKLLPEIATEIYRQYRLDYIGKYSPQFSITKGSIAGYFKLRKQIFLFKTEKIKNIDTKI
ENVDWYLDQIDLAERQTLNQMGSDLDKMIEDDLWPYEKALYIQLKKCEEYLTKTNYKYGT
DLIKQMAMFLEANQDILDFRECYLDNDKSKGVTELLWNMLLLPFNFLNAEFTYWLKRLYY
FIFGNETPLFFKEQQTKQGSKNEVMQYDEYWSRIEDQLADANALMQQQNDDKNQHLKQIL
AQKQSTKVVVGIPNTGVTQKSEKIVIQDLGQKQHEQQPESKLKIVLAPFFGEQTKQSWNP
SANQTQEKSIKIVLGGLQIEPFKSNTYSQDQQMNQMREEQNQQIQLMQSLSHQPIAQHQI
NLSSDQYYDAAQYDDNESVYDEFAEIKFTDTPWLQAAWEILGTLWYHEEAGAFLSPVSED
DLGSYFEDYLRTIDYPMDLSTMKLKAIERLYRNFQEFKRDALTVFRNCQKFNHESSEIHQ
ASVKLENFFKRKLLEYQRFDQAIIRIS