Identifiers and Description

Gene Model Identifier

Contig237.1.g127

Standard Name

TAF12

Aliases

Contig237_1_g127

Description

Transcription initiation factor TFIID subunit A

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03847 ) Transcription initiation factor TFIID subunit A
  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam02269 ) Transcription initiation factor IID, 18kD subunit
  • ( pfam02291 ) Transcription initiation factor IID, 31kD subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR145W0.00000000000006002591555650462TAF12 SGDID:S000002552, Chr IV
from 746738-748357, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig237.1.g127(coding)
ATGAATTCTGGAAGAGAAGGAATCAACCCTTTTGAAACTTAATAAAGAATGAGACCAACT
TCTACTGAGGGAATTTCACAATCTTAACAGGAAAGTGCAGCTGCTTTGATGTATTAGAGG
AATCAGTAATAATAGATGTACTTACAGTAGTAAATGAGAGGCGGCGGAATGCCACAAGGT
GGTCAAATGAGCAGTGGGTAAAGAGGAGGTATGATGCCACCAGGAATGTATCCATAAGGC
TTACCAGGCAGCAGTTACCCTTCAGGCATGGGATCCAGGCCATAAATGATGGGGTATTCA
GGGGGAGATTCACATCATCAAAGTAGTTAGAGTTTTTACCAAGCACCTCCCACTAATTAT
ATGTCAGGCTCTGGAGCATCTGGTTAATCTTAATAATAATAGCAGCAGATGCAATAGAAT
CAATCCGCAAACTAACTAATTGGTCCATTGGATTTAAGAGGAATCACTCAGAAAATCTCA
GCCAAAGAAGTCTTAGACTCTCAAGTAGAGAAGACTTTGGCTTTCCTCGCAGAAGATTTT
GTGAAAACTGTTGCTGAGTTTTCCTGTAAACTTGCCAAGCATCGTGGTTCAGACACCCTT
GAGAAAGAGGATATCAAGTTTGCAATTGAAAAGCTTTATAATATACCCACACCCATAAAG
CCGAACCCAGATAAGCCCTCTAGCTAGTAACTCACATAACAGCAAATTACCAATGTGTCC
ACTAACAATTTCAAATAGAATATGATTTTAGTTAAGAAAGCTCAAGAATAGAATACTAAT
GTTCAAATGAAGTGA


>Contig237.1.g127(protein)
MNSGREGINPFETQQRMRPTSTEGISQSQQESAAALMYQRNQQQQMYLQQQMRGGGMPQG
GQMSSGQRGGMMPPGMYPQGLPGSSYPSGMGSRPQMMGYSGGDSHHQSSQSFYQAPPTNY
MSGSGASGQSQQQQQQMQQNQSANQLIGPLDLRGITQKISAKEVLDSQVEKTLAFLAEDF
VKTVAEFSCKLAKHRGSDTLEKEDIKFAIEKLYNIPTPIKPNPDKPSSQQLTQQQITNVS
TNNFKQNMILVKKAQEQNTNVQMK