Identifiers and Description

Gene Model Identifier

Contig8748.0.g3

Standard Name

TAF11

Aliases

Contig8748_0_g3

Description

hTAFII28-like protein conserved region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( pfam04719 ) hTAFII28-like protein conserved region

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYML015C0.000009002574193719714TAF11 SGDID:S000004477, Chr XI
II from 243029-241989, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8748.0.g3(coding)
ATGGAAAAATCAAGATTCAGTGGAAGCTAAGCTGACGAAGAGGATGATGACTTATTCAAC
ACAGTTAATAGACAAGGAAATAGGTCAAGTGGAGTGGATGCTAATACTAGTAATCACAGA
GAATCAGCTGATATGAGTACTAATGTAATCAGTGCTGGTGGAAATAACTTGCCTAACTTT
GAGTTTGAAGAAGACGATGAGGACAATAACAATAACTTGATTGGCGGTACGGTCGGTAGA
GACGCACTTTTATCATAGAAAGATAATGATGGTGACTAGGAGATGGACGATTAATCTTAC
GATCCTAGTACTGCAGGATAGGAACTTAAGCCCTCCATGTATCACATGATTCATCACTCT
CCTTCTCGATAGTAGTAACATCATAGCTCACAAGATTAGCATACTTCCTCCTAATTAACA
AAAACTCAAACGAGCTCTCATACCTCCTTAAATATTAACCAACCACCCATCGTGCAAGAG
AGGTCTGGGCCTGGTAGACCTGGCAGGCCAAGCAAGCGTGCATTAGCAGCTAAAGCAGGA
GCTGCAGGCAGCTCACAAAATCCTAATTAGTAAGCTCAAAATAGGAACTCTCATTAATTT
GGCTTTGGTAATAGGGATAGAGACCAAAATGACGGCTCTTATGACGATGACTAAGGAAGT
GATTATGGGGGTGATGCTGATTTTACAGAGTTCATTTTTGAGAACAACGAATCAGGTCAA
AAGATCGACTTCAAGAAATTCTCAGATAAAGAGCGTATCAACAGTGTGTTCTCTGCCATG
GACGATATATAGAAGGAGAGATTTGAAACTTTCAGACAGTCTAACTTTGACGAGAAGAAA
ATGAAGAAGATTCTTTCTTCAATTCTAGGCACCACTGGAAAGATGCAGAAAAACATCTCA
ACTATCATAAAATCAGTTGCTAAAATCTACGTGGGGTAGCTTGTTGAGGAGAGCAAACTA
ATTTAGATAGAGGAACTAGAGATAGCTGGAGTGGATGTTGTCAATCAACCAGTTGAGTTG
CATGCGATCTAGCCTCATTAACTCACTGAAGCTCGGAGAAGATTGCTTACTAGAGGGGAG
TTGGTAAGCGAGAAACCTAAGCCGATGTTCAAGAGAAGATGA


>Contig8748.0.g3(protein)
MEKSRFSGSQADEEDDDLFNTVNRQGNRSSGVDANTSNHRESADMSTNVISAGGNNLPNF
EFEEDDEDNNNNLIGGTVGRDALLSQKDNDGDQEMDDQSYDPSTAGQELKPSMYHMIHHS
PSRQQQHHSSQDQHTSSQLTKTQTSSHTSLNINQPPIVQERSGPGRPGRPSKRALAAKAG
AAGSSQNPNQQAQNRNSHQFGFGNRDRDQNDGSYDDDQGSDYGGDADFTEFIFENNESGQ
KIDFKKFSDKERINSVFSAMDDIQKERFETFRQSNFDEKKMKKILSSILGTTGKMQKNIS
TIIKSVAKIYVGQLVEESKLIQIEELEIAGVDVVNQPVELHAIQPHQLTEARRRLLTRGE
LVSEKPKPMFKRR