Identifiers and Description

Gene Model Identifier

Contig4406.0.g109

Standard Name

TAF10

Aliases

Contig4406_0_g109

Description

Transcription initiation factor TFIID 23-30kDa subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03540 ) Transcription initiation factor TFIID 23-30kDa subunit
  • ( pfam12376 ) Protein of unknown function (DUF3654)
  • ( pfam05236 ) Transcription initiation factor TFIID component TAF4 family
  • ( pfam01231 ) Indoleamine 2,3-dioxygenase
  • ( pfam08679 ) Dissimilatory sulfite reductase D (DsrD)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001052300.000009999254677478949hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4406.0.g109(coding)
ATGGCACAAAACTTTTTGCAACAGAATAGAGCTAGTAACTATTCAACATTGAACAATGAT
GTGATTCCAGATAAGAATTTCATTGAGACTGTGGAAGACTATCAACCCAAGATAAACATG
GAGTTAATTAAAAAAATAATGAATGAAGTTGGGATGCAGAGCCCTGATGAGAGAGTGTAC
AAATTAATAAGTGTGATTGTGGAAGCCTAACTTTTGAAAATAATTGAGGAAGTGAAGCAA
GTCAACATTCAAACTCAAAAAGAACCATTCAAGACTCATTTCAGCTTCGAAGATCTGCAG
AAAGCAATGGAAGAGTTTGGAATTGCACTTAGGAGACCACCTTACATTGAAGATAAAATG
AAGATCAAAAAGTGA


>Contig4406.0.g109(protein)
MAQNFLQQNRASNYSTLNNDVIPDKNFIETVEDYQPKINMELIKKIMNEVGMQSPDERVY
KLISVIVEAQLLKIIEEVKQVNIQTQKEPFKTHFSFEDLQKAMEEFGIALRRPPYIEDKM
KIKK