Identifiers and Description

Gene Model Identifier

Contig13378.0.g40

Standard Name

TAF1

Aliases

Contig13378_0_g40

Description

Protein of unknown function (DUF3591)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001932204.9998290395614495e-40hypothetical protein
SGDYGR274C2.9992476920535046e-16TAF1 SGDID:S000003506, Chr VII
from 1043095-1039895, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13378.0.g40(coding)
ATGAGTGAACTACAAAGATTGATTTTCTAAGATATACTTCCCCCTGAAATCCTTGAGAAA
TTAGGGAATATTTCAGACTTAGGGGATGGTGACAGCTATTTGGAAGACATGGATAATGAT
TCAAGGTCCTTAAATGGAAATGCTGCTGCAAATGGAGATTCTTCCATGAGATAAAAGAAT
GGAGCAAGGAGAGGCAGAGGTAGAGGTAGGCGACCCAAGAGAGACTCTGAAGATATGGAG
GAGTCTAACCGCAGAGACTTAAGTTAGAGCGTAGATAAGTCTGCCGATAATGAAGAGGAA
GAGAAAGAAGATAGATTTAGAGATGATTTTAGCATATCAGAAAGCGAGGAGGACAGCAAA
AGTGATAGAAGGCTGCATGCTGATGAAGATTCTTAAGTCATTTAGGAGGGCTATCAATCA
GATAACCAATCTTCGATACTTTCAAGAACTCCCACTACAGGCAGAAAGTTAAAGAAAGGC
AAAGTGCAATTTTCAGACTCAATTCAAGATGACGAAGGGACTAACAGCAACAAATTTTCC
TAATTTCACTAACAATACCAGTCGATGATCGCCCAATAGCAAAGCAACAGTGCTTACCAA
AAGGTAGATCTTTCAGTACTCTACAAAGCTAAAAGTGAGTTAGTTTTCAAACTGACAGAA
CTGTACTTGCCTACCACTAAATCTCAGAAGACCAAAATGTACGAGTACAACAGAGAGAAG
ATGATTACTTAAAATGACATTGAAAATGAGGTATTAAGAGCTAGAAAACGTAAAATGAAG
GAAGAGATTAAGCAAGTTAAGAGCAAACTCAAGCATCAGATTAAGTATTGTAATCCTGCT
CCATTGCTTGAGGACACTCTTTACCTTTACACTCCAGGTATGTCAACAAGATAAATTGAT
ATGATGAGAGACAGCCGAAATAAATATGCTCACGCTCCTCACATAGCCAGGTTAATCCCT
TAAAAGAGACAAATAACATCGCAGTAAATTCTGGATTAGTAAAAAGCTATGCAGCAGCAA
TCCCTAGAGTCTTAGACTCAACTGCCCACATTGTTTGATAGCTCGAATTAGCTGAAATCT
TACTTAATTGAGGATTAATACGGACTCAAGGATGTCACTATACTCGAAGAGCTGGAGCAG
CAACTCACTCGTGAAGAAACTCTGGTTGTAGATAAGGAATACAAAGCTCTTGAAAGTCGA
TATTTCGAGGTTAGTAAGAAGATGCGTGAAAATGAGTTGTCTGTGAGTGATTTGACAGCT
GAAGAGAAGGAAGTCCTTAAGAGATATCTCAAATAGCAAGCCACTGTAGTAGTTGAATCT
AAATACCCAACACTAAAGCTATCAACTTTAGAGAAGCACTGCTACTCCTACATGAAGGGT
CTTAATATCGAAGATTACAGCTTCAAAGGTCAGAAATCAGCCTACTAGAGCGACGACACT
GGCATGTTTATGGAGGACTTTATGCATGGTATTGGAAGTGGAGGAAACAACAATCACCAT
GGAAGTGCAACAAACAATAATCTCACTGCTGCCACATCAATTTCACATTAGATATTTGGC
TTGACTAGGGATGCTTAAACCGACGAAAAGCTCTCTTAATTGTCTGTAGGAGACAATACT
TTCGGAAGACACAAGGACTTCTACAACGAGAATGAAGTCAATGTGAACAATAACATCTTG
CCAAGTGACTATTAGGTTCAGGAGTGGATCACAGAGCAGAAATTCAAGCAAATTAAACAG
TCTTAATCACTTTATACTCAACCAGAAAGTGAGAAAAGAAAAAAGTATTGGGGTGAACCA
ATTGACACTTCATCAATAAAGCAAGTGCAAAAGGACAACTTTATCTACAAAGAGCATCAA
AACAGACAGTACATTTAGAGATAGGGCAGAGATGAAAAGCTCTTCAAAATTGAAAGACAT
CTGCCCAATTCTTAAAACGCTCATGGTAAATCTAAAAGAAATGCTGCTTTAGAATCTCTA
AACACTTTCCCCTCAACTTAAGATTCTTAAAACTCACAGTCAACAATCGCTCTGTTTGGA
AATCATCAAATTAAAGATATCAAGGAGTACGAATACTTCAAAAATCAGGAGAAATACTTC
TATGCTGACGATACAGACACCTCCAAGAAAGTGAGTGTCAATCGTGTCATGAGAAACATT
CAGTTGGAACTTGGCATGATTAATGAGGAGGAGTTTTATCAGTAGGAGGAATTGGAGGAT
ATCTTAGATGTGCAAAGTTAGCAATAATAGATTGCTGCCTAGTCTGGTGTTAGTACTTAA
TTTGCTACTCCGTATGGATCCAAATAGCAACCTAAATCCTTGCATTCAAAAAGCTTAGCA
CTTACTGGTCAATCCAATCCACTCTCATTGTCGTTTCAATCTCAACAGAGGAAAGAACAA
GTATTGAACGAATTCATCGATAACTTTGATGTGCATTTCGAGCGAAGAAAAAAAGAACTC
CATGAAGTTATGCTTAAAAAGATCCAATTACATGAAAAAGCCAATTAGCAGACAAGCAGT
AGTGGATAGCAGTAGACAGTAGCTTATGCGAGTGGAAGCCACGCACTGCTTTAAGCCACA
GCTGCTGGCAACAGTAATGATATGTCCAAGGGTATGGGGCAAGGTGCAGAGGCTAATAGA
GATAAAATCAAGCACATGGTTAACATGAGCAAATTGAGAGAGGATCAGGATTATGGGGGT
AATTCAGGCATGGATAGACACAATGACAATCACAATGGCAACTAAGATGAAGAGATGATG
GGAGATGATATGCATCATAACCATCATAGAGCAGAAACCAATAATAACCAACAGCATTAA
ATGGCGACTGACGATAATATGAGGCTACGTGTGACCAAATCTCGTGCTAATGAACTGAAT
CACGCCAAGTGCATACTTAAACTCACCTACACCAGATTTGACTGGAGTGAACAAGCCCTC
ATGAACTTCCATAGACCCAACATCCATGATGTATTTGAATTGCACTAATATGAGACAGAT
AGAAATCACAAAGAGCAACTACAGCAGCAGTAGTACAACAACTAAATGCAAATTGAATAG
CAATCACATATCCCTCCTACACCTTGTCCATTCATTCAAATGAAGATGAAAGTACTCTCA
CATGATTAGGTTGACAAAAGACCAAAGAAAGTTGGAATCATTAATGCTCATGAATTCTTC
AGAGATAGAATCAAGTTATCGCTTAAAGATGGAAAATTCTGTGTTTTCGAACATATTGAC
CAGCAACCACTATTTATAAATAACTTTGGAATGGCATCAAAACTCAAAAAATACCTATAT
TCAGATAAATTTTTGCCAGATTCAGCTTTCCTCAAGCGAAGAGAGAATTAAGGCACTCGT
CACATGGGGCCACATGGAGCTCAGATATTGAAGAAAAAGGGTGAAAAGATACCACTGCTT
GGCCAAATTGACACTAAATACATAAAGGGAATCACAGTTATGGAGAATAATATGTATTAC
TGCCCTGTATTTTATCACAAACCTCAGAGAAACGATTTCTTATGTGTTTTACACAGAGAT
AAATAACAAAATGCCTCTATTGTAGTGAGAGAACTTTCTGAATTATATGTTATGGGACAG
GAAGAACCTAAGCTAGAAGTTTATAATCCCCAGAGCAGACAGTATTAACATTTCATTAAG
CGCAGAACTTTCTAGGAATTGAACAAATTCTTCCTATACATCAATGATTAGATACTTAAG
AAAATCATAAAAGAAATCAATGTGGAAGTTGATAGAAACCAGTACTGCTCTTTGAATATG
GAATATAATGATGAATAGTTTAGACAGCTCATTACCCCTGAAAATATTTGCCAATATGAG
TCAGCCCAATATGGAGAGTAGATGTTAAAAAAAGTAGGCATCAGAGACATCACAAATGCA
GATAAAATATCTTATGCAACAAACAAGTTCTGTTCGGAAGAGCCAAATCAAAAGAAACAG
CTTATTGCGAGAATTATTGAAGAGGAAGTTCTTAGCACTCCTTGGAACTTATCACAGAAC
TTCATTCATAACAAGTAGACAAGAGGCATGATGATGTTAGAAGGAATTGGTGATCCTTCC
CACGGTCATGGTGGATACTCTTATCTTAAACTTCCCCTTAAGATATCACAAGATTCCCTC
AACAAGGCTAAGATCAATAGAATGTACTTAAACCCAGCAATTTAGAATCCCAAAGCTGTT
ACTGGTACGGATGCAGATTTGCGTAAACTTAGCAAGAAAGAAATTAAAAATAAGTTGATT
GATTTGGGTTTCAAAGAGGAGGCAATTTCTAGCTTCACCAGGTGGGAGATGGTTGCATTA
CTCAGGGACAAAAGTTCTCAAGCAGTTTCTTAAGGAATGGAGGGAGAGATGAAGAAATTT
GCAAGAGGAGTGAGATTTACCTCAAAGAAGCAAAGAGAAATGTATCAGAAATAAGTCAAT
GACATCTTCAAGAAACAGATGAGCTATTTAAGCAAAGAAAGTGGAGATTTTATTCAAGAC
TACTCAGACACTGAAACCAGAGACTAGCGATAGAAAAAGATCAATGATATCTAGTAGATG
AACAACAACTACAGTAAAAACATAGTTGAGTTGAAGGAAGATATTGAAGTTAAAAACATT
AAAGATATTCCCAACTATGAAATACTCATAATGGCAAATCAAGCACTTGGACCTGCCTCT
TCAAATCCAGGTGGTGCTCTCAATATTGGATCCAATTCAGGTATAGGTGGGACATCGCAA
ATTCAAACAGGTTATGATCCAAATACAGGTGTTTTGGACAGAGAAGCTGCAGCTTAAGCT
TTGAAACAAAGATTGAATGATGGTGGGATGACACTCAAGTGCACGATCCTGAGGAAGAAA
ATAAAGCCAGTGAACTCACAAAGCCAAAATGCTAGTGGTTAAGAGAATCAGCCAGACAAA
ATTGAGAGAGTAATTTTCTGTTCAGATCCAAGATAAATCAAAGGTTTCAACAAACGTAAA
CATAAACATGAAGTCAAAATTAAGAGAACTAAGAAAACTAGTCTTAAAGATAAAATGCAA
ACTTTGAAGCCAATTATTGATGATTTCAAGGATAGAAGAGAGAGATCTGAAACTTCAAGC
AATTTGAGACATCCACAAATGACTGCTAGAGGTCCTCAATCTGTCAAGACCAACGCGACT
GTTGAGCCAGTAAAAATTAAGCTTGGAAATTTAACTGGGAACATCCTCTCAGACCCAAAT
AAGTTCTCTAATGTGGACCAGCCCATAAGAATACCAGCTCCCATTCAGATATTCAATCAG
TAACCCACTGGATCAAGCATTCAAATTATGTAGCCAACAGCTTCAAATACTATATCACTT
ATGAATACTGGAGCAGCTTAGTAGCAATAATAGACTCCCTACATCCAAATTCCAATGGTT
TAATAAGAGTAGGCCAACTCAGGCTCATCTTTCAAGATTAATATCTCAAATGTCGCTCCA
CCATCTAGTACTACAATTCAACTTGGAGGATTGACATTGGGAGGTTCAAGCTCTGCTGGT
AAAAACAAGAAACCAAAGATTCAAGAAAAATAATACATATAGCAAGACTAGATTTTGTCT
AATAAACCATATGAAGATAGCAGTGCTCAAATGTATAGCAATAACATGCAATCTGCACCA
GTTCAATAATACTAGTAGTTTGGTTAATTGGAAGATCAGCAGCAGCAATAGTAACTCTAC
TAACCACAGCATCAAATCGACACTCAGCAATAGTAATTACCAGCTGCTTAGACTGGTAGC
AGTATAAAAATCGGTTTAAACCTGGGAGCCATACCCCAATAACAGCAGTAGAAACCTCCT
AAGAAAGATACCATCTAGCTTAATCAATCCCAAATCAACTAATAACCACAGTAGGATTAG
TACTATTAGCAAGAAAGTGGTGCTGGTAGCAGTGGCTATGTATAAGATTCATAATAGCAG
CCATACCCTCAGCAATAATAGTAATACTAGTAATTCGATTAACAGTAGCAGCAACTATAA
GATTAAGCAATGATTTTGGAGTAGTCGTAGTATATGCAGTAGTAACCCAGTTATGACTAC
TCAATAAACACCAGTTACAACAGCAGTGCAACCTAAAACATGTCAACAGTCCCACTTAAC
CCCTCTCCCGCATTCTAGCAACCACAACCCTAATAACCCACTTCAATTAGAATTTCTGAG
CCAGTGAAGATTTCCTTAGGCGGCTTGAATCCATCAACATCCAGTTCCTACCTAGACTCC
TAATTTAACGCTTAGAAGAAGTCAAAACCCACTTCAAAAACAATTGGCTAGCATGTTTAT
GCGAAAGAAGAGAAAAAGAAATCTCAGAAGCCCAAGAAAAACCCTCAACCCTCTAAATTC
CAATCTACTGGCTACAACGATGAGGATTTCGAGACTTACAAGCCTAAAACATTGAATTCT
AGGAGAAGATAGCAATCAGGACTGGCATTACTGAATGAACTATTTAGCTCAATTATTGAT
GCATGCGTTGCCAAGGACAAAGGCAAGATGTTCCACCAGCAGGTCAAAAAGAAGGATGCT
CCCAATTACTATGATGTAATCAAGTTCCCAATTGCTTTGATGGACATGAAAGCCAAAGCT
AAGAGAGAAGACTATTTCTCAAGAGATATGTTCATGCAAGACTTAACTCAAATGAGACTG
AATGCAGAACAGTATAACAGCCCAATTAGTCCAATTTCGGATATAGCTCGCAGCTTGGAA
CAACTCGCTCAAACCATGATTGACCAGGAAGATACCTTAATTAAGGACTACGAATTGCTC
ATTATGGAGTAGCAAAGCCAAGCCTTAAAGATTTGA


>Contig13378.0.g40(protein)
MSELQRLIFQDILPPEILEKLGNISDLGDGDSYLEDMDNDSRSLNGNAAANGDSSMRQKN
GARRGRGRGRRPKRDSEDMEESNRRDLSQSVDKSADNEEEEKEDRFRDDFSISESEEDSK
SDRRLHADEDSQVIQEGYQSDNQSSILSRTPTTGRKLKKGKVQFSDSIQDDEGTNSNKFS
QFHQQYQSMIAQQQSNSAYQKVDLSVLYKAKSELVFKLTELYLPTTKSQKTKMYEYNREK
MITQNDIENEVLRARKRKMKEEIKQVKSKLKHQIKYCNPAPLLEDTLYLYTPGMSTRQID
MMRDSRNKYAHAPHIARLIPQKRQITSQQILDQQKAMQQQSLESQTQLPTLFDSSNQLKS
YLIEDQYGLKDVTILEELEQQLTREETLVVDKEYKALESRYFEVSKKMRENELSVSDLTA
EEKEVLKRYLKQQATVVVESKYPTLKLSTLEKHCYSYMKGLNIEDYSFKGQKSAYQSDDT
GMFMEDFMHGIGSGGNNNHHGSATNNNLTAATSISHQIFGLTRDAQTDEKLSQLSVGDNT
FGRHKDFYNENEVNVNNNILPSDYQVQEWITEQKFKQIKQSQSLYTQPESEKRKKYWGEP
IDTSSIKQVQKDNFIYKEHQNRQYIQRQGRDEKLFKIERHLPNSQNAHGKSKRNAALESL
NTFPSTQDSQNSQSTIALFGNHQIKDIKEYEYFKNQEKYFYADDTDTSKKVSVNRVMRNI
QLELGMINEEEFYQQEELEDILDVQSQQQQIAAQSGVSTQFATPYGSKQQPKSLHSKSLA
LTGQSNPLSLSFQSQQRKEQVLNEFIDNFDVHFERRKKELHEVMLKKIQLHEKANQQTSS
SGQQQTVAYASGSHALLQATAAGNSNDMSKGMGQGAEANRDKIKHMVNMSKLREDQDYGG
NSGMDRHNDNHNGNQDEEMMGDDMHHNHHRAETNNNQQHQMATDDNMRLRVTKSRANELN
HAKCILKLTYTRFDWSEQALMNFHRPNIHDVFELHQYETDRNHKEQLQQQQYNNQMQIEQ
QSHIPPTPCPFIQMKMKVLSHDQVDKRPKKVGIINAHEFFRDRIKLSLKDGKFCVFEHID
QQPLFINNFGMASKLKKYLYSDKFLPDSAFLKRRENQGTRHMGPHGAQILKKKGEKIPLL
GQIDTKYIKGITVMENNMYYCPVFYHKPQRNDFLCVLHRDKQQNASIVVRELSELYVMGQ
EEPKLEVYNPQSRQYQHFIKRRTFQELNKFFLYINDQILKKIIKEINVEVDRNQYCSLNM
EYNDEQFRQLITPENICQYESAQYGEQMLKKVGIRDITNADKISYATNKFCSEEPNQKKQ
LIARIIEEEVLSTPWNLSQNFIHNKQTRGMMMLEGIGDPSHGHGGYSYLKLPLKISQDSL
NKAKINRMYLNPAIQNPKAVTGTDADLRKLSKKEIKNKLIDLGFKEEAISSFTRWEMVAL
LRDKSSQAVSQGMEGEMKKFARGVRFTSKKQREMYQKQVNDIFKKQMSYLSKESGDFIQD
YSDTETRDQRQKKINDIQQMNNNYSKNIVELKEDIEVKNIKDIPNYEILIMANQALGPAS
SNPGGALNIGSNSGIGGTSQIQTGYDPNTGVLDREAAAQALKQRLNDGGMTLKCTILRKK
IKPVNSQSQNASGQENQPDKIERVIFCSDPRQIKGFNKRKHKHEVKIKRTKKTSLKDKMQ
TLKPIIDDFKDRRERSETSSNLRHPQMTARGPQSVKTNATVEPVKIKLGNLTGNILSDPN
KFSNVDQPIRIPAPIQIFNQQPTGSSIQIMQPTASNTISLMNTGAAQQQQQTPYIQIPMV
QQEQANSGSSFKINISNVAPPSSTTIQLGGLTLGGSSSAGKNKKPKIQEKQYIQQDQILS
NKPYEDSSAQMYSNNMQSAPVQQYQQFGQLEDQQQQQQLYQPQHQIDTQQQQLPAAQTGS
SIKIGLNLGAIPQQQQQKPPKKDTIQLNQSQINQQPQQDQYYQQESGAGSSGYVQDSQQQ
PYPQQQQQYQQFDQQQQQLQDQAMILEQSQYMQQQPSYDYSINTSYNSSATQNMSTVPLN
PSPAFQQPQPQQPTSIRISEPVKISLGGLNPSTSSSYLDSQFNAQKKSKPTSKTIGQHVY
AKEEKKKSQKPKKNPQPSKFQSTGYNDEDFETYKPKTLNSRRRQQSGLALLNELFSSIID
ACVAKDKGKMFHQQVKKKDAPNYYDVIKFPIALMDMKAKAKREDYFSRDMFMQDLTQMRL
NAEQYNSPISPISDIARSLEQLAQTMIDQEDTLIKDYELLIMEQQSQALKI