Identifiers and Description

Gene Model Identifier

Contig22251.0.g51

Standard Name

TADA2

Aliases

Contig22251_0_g51

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007907302.0001081030036656e-67Myb-like DNA-binding domain co
ntaining protein
SGDYDR448W2.9989272749380808e-50ADA2 SGDID:S000002856, Chr IV
from 1356065-1357369, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22251.0.g51(coding)
ATGGATAACTCACCTTCATCATAAAAAAAGCGCACATCCAAGCAGTCAGTTAGACAACTC
GAAGATGATGTATAGGGACATGCACCAACCTCTTCAAGAAACAATAAAAGAAAGGACGAG
TAACAATCTTAACAAAAGATGCAGCAATTTTTCAATAGTTTGAAGGATATCGATTAACTT
ATAGGGCCCAACACTTGTGGCATTTGCGATAGAGATATTGGCAAGAGTATCAAGATTAAA
TGCTTAGGCTGCGTGGAACAACCCCTTAGTTTGTGCTTAGAATGCCTGAGAATGGGTAGA
ACAGCTCCAGAACTTCCAGAGCACAAAGCAGAACATGAATACCATGTTTATGACAATCTC
AGTTTCCCTCTTTTTACTAAAGATTGGACTGCGAAAGAAGATCTACTTCTTTTACAAGGT
ATTATGAAGTGTGGCCTGGGAAATTGGACAGATATTGCTAGCTAATTTGTTGACTCTAAA
ACACAAAAGGAATGTGAAGAGCACTACTACAACTTTTATTTCAAGAACAAGAATGATAAG
CTTCCATCAAATGAAGATTTTATCGTGTAAGGTCCAAAGCAAGTGAGACCTGACGGTTCT
GTTTATTTGCTGATTGATGAAGAAAAGAACAATATTGCGCAAAAGAGAATCAGAGATTAT
TAGCTAAGAAAGAAGGCTGAGGTTGAAGCCGAAGAGAAGGAATTTTGTCAAGCTGCCAAC
CTTGCTCAGAATGAACAGAGTAACAATAACTAATAAGCTGGTAGATAAGGCAAAGCCTAG
AGAAGAGAGAATTCAGGTTTACCAGATCTGCATTAAGTGGTTGGATACTTACCAAAGAGA
GGAGATTTTGATCAAGAATATGATGGAGATGCGGACACCTTGCTCGCAGATTTAGAGTTC
TTTGAAGATGAGTCAGAGTCTGATATCAAATTCAAACATGAAGTCATTGAACTTTATAAT
GCTAGAATTGATGAAAGAATCAGAAGAAAGAAATTTGTGATTGAAAGAGGTCTGCTTGAT
TATAAGAAAAATTAAAAGCTAGAGAGACAAAAGACTAAAGAGGAGAGAGAAATTATCACT
GCCATGAAGATATTTGCAAGATTCAATACTGCTGAAGATCATGAAAAATTAGTTAACAGT
TTGATCAAAGAGAGATTACTGAGAGAAGTTATCGAGTAACTCAAGCATTTCAAGTCTAAG
GGGCTCACCAGCTTGGATTAGATTGAGAAATATATTGAGGCACAAAAGAAGAAATAAAAT
TCTTCATCAACTTACAATCAAAGTAGTTTCTATCAAGAGAGACCAAGATTCGGAGAGACA
GAGGAATTCTTGAAAAATCCAAGAGAATTTATAAGCTCAAAAGCTGATGCAACTCTTGAT
GCCACTTCACTTGATAGAAAATTCCTGAAAGGGCAAACCAAGTAAATAGCAAATTCAAGT
GTAATGATGGCTGAACCTCGCTGGGAAGAGCTTGACAATAAAGAAAAGAATCTATGTTCA
ACTATGAATATCAAGCCAGATGATTACCTTAAGCTAAAGGCTAAATTGTTTGAGGAAAGA
GCCAAGAATAAGGCAATTACACAGTAGTTACTTGCTTAAACTGGAAAAGACTTCAAAAGC
TTAAGAGAGAAGATACCTGATGTTTATGAATTCTGGGTGACCACTAAATTAATTTCACAG
TGA


>Contig22251.0.g51(protein)
MDNSPSSQKKRTSKQSVRQLEDDVQGHAPTSSRNNKRKDEQQSQQKMQQFFNSLKDIDQL
IGPNTCGICDRDIGKSIKIKCLGCVEQPLSLCLECLRMGRTAPELPEHKAEHEYHVYDNL
SFPLFTKDWTAKEDLLLLQGIMKCGLGNWTDIASQFVDSKTQKECEEHYYNFYFKNKNDK
LPSNEDFIVQGPKQVRPDGSVYLLIDEEKNNIAQKRIRDYQLRKKAEVEAEEKEFCQAAN
LAQNEQSNNNQQAGRQGKAQRRENSGLPDLHQVVGYLPKRGDFDQEYDGDADTLLADLEF
FEDESESDIKFKHEVIELYNARIDERIRRKKFVIERGLLDYKKNQKLERQKTKEEREIIT
AMKIFARFNTAEDHEKLVNSLIKERLLREVIEQLKHFKSKGLTSLDQIEKYIEAQKKKQN
SSSTYNQSSFYQERPRFGETEEFLKNPREFISSKADATLDATSLDRKFLKGQTKQIANSS
VMMAEPRWEELDNKEKNLCSTMNIKPDDYLKLKAKLFEERAKNKAITQQLLAQTGKDFKS
LREKIPDVYEFWVTTKLISQ