Identifiers and Description

Gene Model Identifier

Contig284.0.g3

Standard Name

T2SS1

Aliases

Contig284_0_g3

Description

Type II secretion system (T2SS), protein M

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04612 ) Type II secretion system (T2SS), protein M
  • ( pfam11262 ) Transcription factor/nuclear export subunit protein 2
  • ( pfam03796 ) DnaB-like helicase C terminal domain
  • ( pfam10458 ) Valyl tRNA synthetase tRNA binding arm

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig284.0.g3(coding)
ATGGATCTGTAGCTTGGAAAGTATGTTAACAAACAGCTAGAAAGAAGAGTCAACAGACTT
AACAATGAAGGGGAGAGCTTTGCAAGTATATCAAGATTTACTACAGTAATGTCTGGAGCC
AATAAATTTATAAATAATATAAAGACTTAGATAAACAACAGAAGAAATGGTATTAATTCT
CTTGAGACCTAAAGAAAAATGCTTAATAGCACTGTTGTCCTACCTGAATCTCATTTAAAA
AGTGGAACTCTTCAAGACTCTAATCCTCTATAAAATAAAATCCTATCCTCCACAACCTAA
ATCCAGAACTTAAATTTTCAAAAAATCTACAAAGACACAAAAAAGTAAATGGAACTCTAA
ATTATGCGTGAAAACTATAAAAACCTCCCAAGTGCAAGAATTTTAGATAAACTAGACTTT
GACACTGAAAATTATGATAAAAATTTATAAGTTTATCGCAAGAAATATCGGTATTAGGAA
TATTAAGAGAAGATTAAACAGTACTAAGAGTAAGTTGAGAAAGTTGATTAACATTTGAAG
AGTGGTAATAAAACGAAATAATAATAGAAATATGTAGGGTAAAATAAGAGGATTTAGGAG
TAGAATTTTGAACAGTTCTCTGAGGTTTTGAGTTAAGAACTTTCAAGCTATTTTGAGGAA
GAAAATAATGGGGGGAATATTAATAATTTAAGAGTTAATGAGAAAAGTAAGAATCATAAT
TCAGGGGATACTGTGAACTATCAAACATCATCCACTCCAAGACTACCTTTAATAAAGTAT
TGA


>Contig284.0.g3(protein)
MDLQLGKYVNKQLERRVNRLNNEGESFASISRFTTVMSGANKFINNIKTQINNRRNGINS
LETQRKMLNSTVVLPESHLKSGTLQDSNPLQNKILSSTTQIQNLNFQKIYKDTKKQMELQ
IMRENYKNLPSARILDKLDFDTENYDKNLQVYRKKYRYQEYQEKIKQYQEQVEKVDQHLK
SGNKTKQQQKYVGQNKRIQEQNFEQFSEVLSQELSSYFEEENNGGNINNLRVNEKSKNHN
SGDTVNYQTSSTPRLPLIKY