Identifiers and Description

Gene Model Identifier

Contig21128.0.g78

Standard Name

SWC2

Aliases

Contig21128_0_g78

Description

YL1 nuclear protein C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21128.0.g78(coding)
ATGAGCGACGACGAACAACAAGATCTCAACTTATTTGAGGACTTGACAACTCAATTCAAG
AAGACAGGCCAAGATGCTATTGCTAAGTATCAAAAGTAAACTGCAGAGAGACAGCAAAAC
CAAAAGATCACTCAATCAAAAGACAATCAGGATAATGATGATGAGGAAGATAAAGAGTCA
TACTATGACTCAATGGAGTATGGAGATGAGCTTAATGATGATGAAGAGTAAAGTTACAAA
AAGGAGAGAGCTGAATAATCACAAGTAAAGAAGGGAATTTTGAAGAAGACTGAAGCTAAT
AACAAAAAAGAGATTGAGGAGTCAGAAGATGATGATGAAGAAGAAGACAAAGATCAAAGT
GAGAGTGATCAAGAAAATGAAGATGAAGAAATGGATGAGAAGAGTGGAAGTGATGATTAA
GAAGAGGAGGAAGATGATGATAATTAAAGCGATGAGGATGATGAAGATTAATAATCAAAT
TAAATGAAAAAGAAAAATAAGAAAGAATAACCAAGACATACGAGAGGTTCTAAGAAACAA
TTCAAAGAAGACCTTGAAGAAGAAGAAGATGATGAGGATGAAGAGTAAGATGAAGAGGAT
GGGGAAGACGAATAAGAGGAAGATGAGGAGGAAGAAGAAGAAGAGGAAGTTAAAGCTCCT
GAACCTAAGGTTTTACCTTCAAGAGCTACTCGTGGTCTCAGAATGAATTTGTTAGTCGGC
AAAGCACTCGAGGAAGATGCTTAGTTTTGGAATTAAGGGCTTTTCGCTGAGGATAACTCT
GATGATGACTTCAATTCAGAGGAAATCTCAGAGTCAGCAGCTCAAGATTCATTCGATTCT
GACTTTGAAAACTCAGCCAATGAAAAGGACTAAGATGACGAAGGATAAGAAGCTAAAGGT
GGTAAAAGAAGTAATGCAGTCCGCAAATCAAGCAAGGGACAGGATGAAGAAGATAATGAT
TATGAAGCTGACAAGAGACTTGCCCTATAAGAGCGAAAAGATTTGTAAAAGAAGAAAGTC
ACATTTGGAGAATCGAAGAAGGCAAGAGATGCGAAGAGGAAGAGAAAAGATGAGGAGAGA
AAGAAGAGACATGATAAACCAGATAGGGATAACTAGGAATAAGATTTGGAATCACAAGGT
GAATAAGAAGAAGGTGACGAGGAAGACAATTCTGGAGATGATGATCAATAAAATGAAATA
AGAAGAAGCTCCAGATTAGAGAAAAAAGTAAAAGTGAGGGAAGACAAGAGCTCAATCCTC
AAGAAACGACAAGAAAGAGAGAAAAAAGAGGCACCACCAGCTGGAGAGAGTGATGGTGAG
CAGTAATAATAATAGATCCTTAGCCAACCCAGATTGGGATTGAATGTTGGGCTTGGATGC
GTAATCCAAATGATGATGCAAGAAGCTGCATTTACTGAATTGATAAACAAGAGATCATTA
GAGTAACTTGAGAAACTCGAGAACGATAGGCAGAACGAGTTAGCAGATAGAAAATCTATT
TTTGCTCCTGACGAAAAAATCATATCCTTCAAGCAAACTACTAAAGGAGGCCAGTTTTAA
AGTACTTACACTTTTCCTTCAGCTGATTTCTACCCAAAACAGTTCAACACAAAAATCTCC
AAAAAGGATGGCTTGAAATATCAAGAGTTAACTTGCTCTATCACAGGGTAACCCGCAAAA
TATAAGGATCCCTTGACTGGACAGCCATACTCAAACAAGGAAGCTTTCAAGATTATAAGA
GAAAAGTACTTCCAGAAAGAGGAAGAGAAGCTTTTCGTGAGACTCTAAGTTCTTAATGAT
CTGCTCGCTTAGAAAAGAGATAAACTTCGCAGGTATCACTAGGGCAATAGAAATTTGGAT
TTAACTGAGCCAATGCGATCTGTAATATTGAAGAACTTGGCTAATTCTCAAAACATAAAG
AAGACATATGGTAATTTTGGCATGAATGACGAGTTGCAAGTAAAAAACAATTTCAGTAGT
TTAAATAAGAATGAAACTGAGAATTAAGACTAAGTTATGAATACTGAATCCAATTTAGAC
AATGAATAAATTATTGAGGGTGTAATGCTAGAGAATTAAGAAGAAATCTAATAATAGGGA
TTCGAAGAATAATAGCAAGTGCTTGAAAGAACAGAAGTCTCTGATGTGAAACTAGAGTAA
GATCTTATGATGAAAGTTGAAGAGGAGTGA


>Contig21128.0.g78(protein)
MSDDEQQDLNLFEDLTTQFKKTGQDAIAKYQKQTAERQQNQKITQSKDNQDNDDEEDKES
YYDSMEYGDELNDDEEQSYKKERAEQSQVKKGILKKTEANNKKEIEESEDDDEEEDKDQS
ESDQENEDEEMDEKSGSDDQEEEEDDDNQSDEDDEDQQSNQMKKKNKKEQPRHTRGSKKQ
FKEDLEEEEDDEDEEQDEEDGEDEQEEDEEEEEEEEVKAPEPKVLPSRATRGLRMNLLVG
KALEEDAQFWNQGLFAEDNSDDDFNSEEISESAAQDSFDSDFENSANEKDQDDEGQEAKG
GKRSNAVRKSSKGQDEEDNDYEADKRLALQERKDLQKKKVTFGESKKARDAKRKRKDEER
KKRHDKPDRDNQEQDLESQGEQEEGDEEDNSGDDDQQNEIRRSSRLEKKVKVREDKSSIL
KKRQEREKKEAPPAGESDGEQQQQQILSQPRLGLNVGLGCVIQMMMQEAAFTELINKRSL
EQLEKLENDRQNELADRKSIFAPDEKIISFKQTTKGGQFQSTYTFPSADFYPKQFNTKIS
KKDGLKYQELTCSITGQPAKYKDPLTGQPYSNKEAFKIIREKYFQKEEEKLFVRLQVLND
LLAQKRDKLRRYHQGNRNLDLTEPMRSVILKNLANSQNIKKTYGNFGMNDELQVKNNFSS
LNKNETENQDQVMNTESNLDNEQIIEGVMLENQEEIQQQGFEEQQQVLERTEVSDVKLEQ
DLMMKVEEE