Identifiers and Description

Gene Model Identifier

Contig14945.0.g39

Standard Name

SVR1

Aliases

Contig14945_0_g39

Description

RNA pseudouridylate synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002799403.9983507938127826e-75conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14945.0.g39(coding)
ATGTTGAAATTTTTACCATTAGCTAAGCTTTTCCATAAAGCCTCATTGAATTAAACAATA
ACGTTTAGTTAGGCAAGTTTCGCAAGAGCAGCAAGACATCAGCACAAATTAAAAAGTACT
TAAGTAAATGAGAGCAAAGATTAACAATCCAACACATCATCTAGAGAAGAAAGAGGCGGT
AGATTTAGCAAAACAAGGCAGTAATAATAACCAGAAAATGATTTCAAAGAGAGAAGTCAA
GCGAAATCAACATAGACTTAAATGGCCGAAACTAATTCTAAGGATGTTAAATTCAAGGTT
GAAGTACCAAAGATTAAAGTCGAGAAGTATGAGGCTCCAACTATAGTTAAAGGGGGTATT
GAAATGCTAGACCCTAAAAAATCAAAGTACGGTCTATCAAGAGAAGAGAAAAATCAAAAG
TTATAAGAAAATAGATAGAAAGCTCCAGACTATCTGAGAAATGATCAAATGTATAAGGAT
TTCACTAAGAAAGACTATGAAATGGAAAATCCCATAGAAATTAAAGAGAGAGTGAAAGAA
CAAAAAATGCTCGAAGAATCTAAAAGACCCTCATCAACAGATAAATTAGGGTTCTAGCCT
AAGCCAAAAAAGAGCACTTAGAAATAAATATCTATGGATCCCATTGCTAAGAAAGTTGCG
ATATCTGAGCATGAAAGAAGACTATAAACTTTTGATAGATTTAATGAAGAATTTGTGACT
GCTTATATATCGGAGAAATCACAGAAAAAAATCAGAGTAATCAATAAGGAAAATGAGTCT
CCTCTAGACAACTTTGTCAATGTATCAAATATTGATGAATTCTAAAAGCCCGAAAGAGTG
TCAAAGAGACTAGCTCGCATGGGCATATGCAGCAGAAGAACAGCTGAGAAATTAATTGAT
TAAAGAATGGTGAAAGTAGACGGCAAAGTGATTGACTAAAATATGCAAGTTTCAAATCAA
AACATCGTTCAAATTGCTGCGAAGACAGGGATTTATACACCTGTCAAGGAAAACACAAGA
ATATGGCTTTATCATAAACCCAGAGGAATGGTAACTACACATGCTGATACTCATGGAAGA
AAGACAGTGTTTTAAGATTTGTTTAATAGTGGCCTAAAAATTCCTCATGTTATTAGTGTT
GGAAGATTAGATTTCCTGTCTGAGGGATTGATGATTATTACAAATGACGGAGAAATGGCA
AGAGCACTAGAGATGCCTTCCTATGCCTTAGAAAGAAGTTATCGAGTAAGAGTGTTTGGA
AGAATGTTTAATGAAGATAAATTAAGAAGAATCAAGGCTGGAATGATGATGGGTGGCTAA
ATGTATGGTCCTTATATTTGTGAATTAGAAAAGAGATAAACAACTAACACTTGGCTCTTT
ATGAAGCTCTTCCAAGGAAAAAACAATGAAATTAGAAGAGTTATGAGAAAGTTGAGTTTA
AGAGTCAACAGATTGATAAGAACATCTTATGGACCCTACACCCTAGGCCAAGTGCCTAAT
CCAGGAGATATTTAAGAGGTAACTGTATCGCAGGATATTAGGAAAATCTTGTTTAAATAT
TATCAGGATCGAACTAGAGGAGCTTAAGCTAAAATGAATGATGCTGAGAATGAAAAGACA
AGGATGTAAAATCAAATAGTTGACAGGATTATTGGATCAGAAAATAATAAAGGTGACATC
AAAATGCCTCATTAATAATCAGAAAAAGTATATCTACAAGAGAGCTCTAAAGATAACTTT
GATGAGGAAGATCTTTTGGAATTAGAAGACTATCCAAGAGAAAGCTCTAAAACATACAGC
CCAAGCAGTGGTTTTGGATCTCAAATATTAAACTAGACTAATGAGTAAAATCAGAGATGA


>Contig14945.0.g39(protein)
MLKFLPLAKLFHKASLNQTITFSQASFARAARHQHKLKSTQVNESKDQQSNTSSREERGG
RFSKTRQQQQPENDFKERSQAKSTQTQMAETNSKDVKFKVEVPKIKVEKYEAPTIVKGGI
EMLDPKKSKYGLSREEKNQKLQENRQKAPDYLRNDQMYKDFTKKDYEMENPIEIKERVKE
QKMLEESKRPSSTDKLGFQPKPKKSTQKQISMDPIAKKVAISEHERRLQTFDRFNEEFVT
AYISEKSQKKIRVINKENESPLDNFVNVSNIDEFQKPERVSKRLARMGICSRRTAEKLID
QRMVKVDGKVIDQNMQVSNQNIVQIAAKTGIYTPVKENTRIWLYHKPRGMVTTHADTHGR
KTVFQDLFNSGLKIPHVISVGRLDFLSEGLMIITNDGEMARALEMPSYALERSYRVRVFG
RMFNEDKLRRIKAGMMMGGQMYGPYICELEKRQTTNTWLFMKLFQGKNNEIRRVMRKLSL
RVNRLIRTSYGPYTLGQVPNPGDIQEVTVSQDIRKILFKYYQDRTRGAQAKMNDAENEKT
RMQNQIVDRIIGSENNKGDIKMPHQQSEKVYLQESSKDNFDEEDLLELEDYPRESSKTYS
PSSGFGSQILNQTNEQNQR