Identifiers and Description

Gene Model Identifier

Contig13621.0.g36

Standard Name

SUV3

Aliases

Contig13621_0_g36

Description

Mitochondrial degradasome RNA helicase subunit C terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam12513 ) Mitochondrial degradasome RNA helicase subunit C terminal
  • ( pfam00271 ) Helicase conserved C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007259305.999393432078778e-90Helicase conserved C-terminal
domain containi...
SGDYPL029W5.002220803647507e-75SUV3 SGDID:S000005950, Chr XVI
from 495506-497719, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13621.0.g36(coding)
ATGTTAGCTAGAAAATTGACCCAATTACTCTAAATTCAATAAAGTAATCAGCTTAACCTT
GGTAAAATCTTGCTAAATTCAAGGTTGCTGTCTTAATCAACCATGAATTTTGCTTCTTTT
CGTGCTAATCGAGATAAATTCAAAGTAGAGAAGCAGTTTGTTAAAATTGAAAATGATGGT
ACTTTAAATGTTTTAGACAATGAATTTATAAGATAATTGGAATTAGAAAGCAATAATGAC
TTTACATTCGATAATGAGGATAGGCGTCGTAAAGAAAAACACGAGTTTAATAGAGAAGAG
AGGAGGTAAAAATCGAAGGAGAGAGAATTGAACATTAAAAAGTAGAGAGAATTTTAGAAG
AATGAACATCACAAGTATGAGTATGATGAGAAAACACATAGAGTTAAGTTGAAGGAGGAT
GATAAGAAAGGGTTACATCACAAAGGAATCACTGAGAAAGACTATCTCAAAGCTGTGTTT
TCAAGGCAAGAATTCAAGAATTACATGAGTTAGCAATATCAAATCATTCCGCTACTCATC
TCTCCTGAAAAAATTAACAAGTTTGTATAAGAAATTGAGATTAATGGCAAGTACTAAGAC
CACATAAAAAGATGGCAAGTTATTTCAAGATAAGATAAGAGAAAGTTCATGTACAGAGCA
AAGCCATATATTGAACTTTACACAGATTTCATCTTGCGCTATTTCAAAGAATAATTTGAA
AATTCTCAGCAACTTGTGAGCATGACTGACTTGACAATGCCTCATGAGTGGTTCCCTGAA
ACTAGGAAAATGAAGAGAAAAATATTCTATCATATGGGACCTACCAATAGTGGGAAAACA
AGAGGAGCGATTTAAAGATTGATGGAAGCTAAGAGTGGACTTTATTGTGCTCCACTTAGG
TTGCTTGCTTGGGAAATATCAGAGACTTTAAGTAACTATGGTATTCCTTGCAATTTAATC
ACTGGCTAGGAAAAGCAATTAATGGTTGACAGTCATCACTTATCATGCACAGTGGAGATG
GCAGATTTGCAAAATGAATATGAAGTTGCAGTTATTGATGAAATACAAATGATTGACGAT
CCTGAGAGAGGGTACGCTTGGACAAATGCGTTGCTTGGTCTCAAAGCTCACGAAATACAT
ATAGTTGGAGAAGAGAGAGCTTTGTCACTCATCGATAGAATGGTCTAAGATACAGGTGAT
GAGTTATTCATTAACAACTATGAGAGATTGAGCACACTATAAGTAGAGCACAAGACCATC
AGGTCTTTTTCAGAGTTCAAGTCTGGTGATTGTATTATTGCTTTTTCTAGAAGAGAGTTA
TTCCAGATCAAAAGTCAATTAAACAAGCATATCCGAGGACAGCAACAAGATAAAGAACAA
AAGCAAAATGACGAAGAAGTCAATCACTGTGCCATTATTTATGGAGCTTTACCTCCAGAA
TCAAAGAAAAATTAAGCATTTATGTTCAATAACAGAGTAGGTGACATCAAATATCTTGTA
GCTACAGATGCAATTGGAATGGGATTGAACTTAAGCATTAAGCGCATTATATTTTCAACA
TTAAGCAAAAGAGTAAAGGGTAGAACTGAGCAGGTGAATGAATTTCATATCAAGTAGATT
GCTGGAAGGGCTGGAAGATATATTGAAGATGGCTATGTTACAGCATTTAGAGACAGAGAT
CTGCAGCAGATCAGACAAGTAGTAGGGAAATATGAGAAGAAAAAAGGCAACGAAGTAAAT
GAAGAAACTACGTCACAAGCAGAAGAATCTTCATAGAGGAAAAATAGAAGAGAAGAGAAT
TTAGTTATGGATTCCGAGGAAGAATAGGAATTGGGTGAAGAAGTTAAAACCAAAATGTAC
AACTCTATTGAAATGGAAGAGGTTTTCGATGAAAATACAATACCAATTGAAAAGTTGAAA
AATCGTTAATTCACAAAGCTTCAGTAACACATCAGCCGTGCTTGCCTTTTCCCTCCCTTC
CAAATGATTCAGTAATTCGCAGATGATCTATATTTCTCAGATAAAAAGTAGCACCGACTA
TCCGAGGTAATCTAAAAGTTTGAGTTCTTAGCGAGACTTGGATAGAATTACTTTATTAAG
AACAACTTAGAAATCAGAATACTCTCTGATTCATTAGAGGATATTCCTAATTTCTCTCTT
AAAGATCAGTATACTTTCTCTTTAAGTCCTATGAAAGTGCCCCTGAATTAGAGAAAGAAA
GTAAGAAAGCTAAGTTAACTGAGGTCTTTTGCGGAGTAATTTGCAGCCTACGGTAGAGTT
GATCTTCCACCTGATTTCAATATTAGCAATATAATTTTGAATAAAACCAGCTATGATGAG
AATGATCTGGATACACTTGAGGAAATGCACAATATTCTGGAAGTATACTTGTGGCTTGGC
CATAAATACGAATCAGCCTTCGCAGAAATGGATTTATGCAGGATTATTGCAGAAAATGTG
ATTAAAATCATAGATCAAATTCTTCTCGGAAAAGAGAAAATAGACTGGTTTGCTCAAAGC
TCAGAGGGCTCAGGCACCATGATTAACGCTTGTTTCGGAACAAAGTGCTGTGCTGGTTTC
ATCTATGGTCTTTTGCAATTCTTCCTCACAATATTGCTGATTGGGTGGATCTGGTCCATC
ATGTATGGAATTAAGATTTTATAAATGAGTGGCAGAAGTGGTAAGCACTATCATCAACAC
CATTGA


>Contig13621.0.g36(protein)
MLARKLTQLLQIQQSNQLNLGKILLNSRLLSQSTMNFASFRANRDKFKVEKQFVKIENDG
TLNVLDNEFIRQLELESNNDFTFDNEDRRRKEKHEFNREERRQKSKERELNIKKQREFQK
NEHHKYEYDEKTHRVKLKEDDKKGLHHKGITEKDYLKAVFSRQEFKNYMSQQYQIIPLLI
SPEKINKFVQEIEINGKYQDHIKRWQVISRQDKRKFMYRAKPYIELYTDFILRYFKEQFE
NSQQLVSMTDLTMPHEWFPETRKMKRKIFYHMGPTNSGKTRGAIQRLMEAKSGLYCAPLR
LLAWEISETLSNYGIPCNLITGQEKQLMVDSHHLSCTVEMADLQNEYEVAVIDEIQMIDD
PERGYAWTNALLGLKAHEIHIVGEERALSLIDRMVQDTGDELFINNYERLSTLQVEHKTI
RSFSEFKSGDCIIAFSRRELFQIKSQLNKHIRGQQQDKEQKQNDEEVNHCAIIYGALPPE
SKKNQAFMFNNRVGDIKYLVATDAIGMGLNLSIKRIIFSTLSKRVKGRTEQVNEFHIKQI
AGRAGRYIEDGYVTAFRDRDLQQIRQVVGKYEKKKGNEVNEETTSQAEESSQRKNRREEN
LVMDSEEEQELGEEVKTKMYNSIEMEEVFDENTIPIEKLKNRQFTKLQQHISRACLFPPF
QMIQQFADDLYFSDKKQHRLSEVIQKFEFLARLGQNYFIKNNLEIRILSDSLEDIPNFSL
KDQYTFSLSPMKVPLNQRKKVRKLSQLRSFAEQFAAYGRVDLPPDFNISNIILNKTSYDE
NDLDTLEEMHNILEVYLWLGHKYESAFAEMDLCRIIAENVIKIIDQILLGKEKIDWFAQS
SEGSGTMINACFGTKCCAGFIYGLLQFFLTILLIGWIWSIMYGIKILQMSGRSGKHYHQH
H