Identifiers and Description

Gene Model Identifier

Contig18025.0.g12

Standard Name

SUMO1b

Aliases

Contig18025_0_g12

Description

Ubiquitin-2 like Rad60 SUMO-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004101303.999374135750469e-31hypothetical protein
SGDYDR510W6.000675497867615e-22SMT3 SGDID:S000002918, Chr IV
from 1469400-1469705, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18025.0.g12(coding)
ATGGCAGACACCGCTTCAGCAGCAGCCCCAGCAACCGCCTCCGCAGGCACAACCCAGCAA
GACCCCCACATCAACATCAAAGTGAAGTCCCAAGATGGCACTGAGATCTTCTTCAAGATC
AAGCGCACCACACAACTAAAAAAGCTTATGGACGCATACTGCAACAGATAAGGCCTCTCA
ATCAATCAGTGCAGATTTATCTTCGATGGAGAGAGACTAAAGGATGATGACACCCCAGAT
AAGCTCGAGATGGAAAATGGAGACGAAATCGATGTCATGGTAGAGTAGACTGGAGGCTAC
TTACTATCAGAACTATGGGCAAGTAAATAGTGA


>Contig18025.0.g12(protein)
MADTASAAAPATASAGTTQQDPHINIKVKSQDGTEIFFKIKRTTQLKKLMDAYCNRQGLS
INQCRFIFDGERLKDDDTPDKLEMENGDEIDVMVEQTGGYLLSELWASKQ